SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5L1Q7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5L1Q7
Domain Number 1 Region: 47-86
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000000392
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2K5L1Q7
Sequence length 102
Comment (tr|A0A2K5L1Q7|A0A2K5L1Q7_CERAT) Regulatory subunit of type II PKA R-subunit (RIIa) domain containing 1 {ECO:0000313|Ensembl:ENSCATP00000006875} KW=Complete proteome; Reference proteome OX=9531 OS=Cercocebus atys (Sooty mangabey) (Cercocebus torquatus atys). GN=RIIAD1 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Cercocebus.
Sequence
MLSVRSVSEDICSRIYESAQRIDSITFLPSSDFHLKWKIQTRIANEKYLRTHKEVEWLIS
GFFREIFLKRPDNILEFAADYFTDPRLPSKIHMQLIKDKKVA
Download sequence
Identical sequences A0A2K5L1Q7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]