SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5L4S5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5L4S5
Domain Number 1 Region: 456-513
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.25e-24
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 2 Region: 540-597
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.36e-23
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 3 Region: 176-233
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.44e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 4 Region: 400-457
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.12e-23
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 5 Region: 232-287
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.12e-21
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 6 Region: 291-345
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.59e-21
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 7 Region: 344-401
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.79e-21
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 8 Region: 2-59
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.62e-20
Family KRAB domain (Kruppel-associated box) 0.00054
Further Details:      
 
Domain Number 9 Region: 138-190
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.76e-19
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 10 Region: 582-634
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.17e-18
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 11 Region: 503-535
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000543
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 12 Region: 91-147
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000973
Family Classic zinc finger, C2H2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2K5L4S5
Sequence length 641
Comment (tr|A0A2K5L4S5|A0A2K5L4S5_CERAT) Uncharacterized protein {ECO:0000313|Ensembl:ENSCATP00000007946} KW=Complete proteome; Reference proteome OX=9531 OS=Cercocebus atys (Sooty mangabey) (Cercocebus torquatus atys). GN= OC=Catarrhini; Cercopithecidae; Cercopithecinae; Cercocebus.
Sequence
MDSVVFEDVAVNFTQEEWALLGPSQKKLYRDVMQETFVNLASIGENWEEKNTEDHKNQGR
KLRSHMVERLCERKEGSQFGETISQTPNPKPNKKTFTRVKPYECSVCGKDYMCHSSLNRH
MRSHTEHRSYEYHKYGEKSYECKECGKRFSFRSSFRIHERTHTGEKPYKCKQCGKAFSWP
SSFQIHERTHTGEKPYECKECGKAFIYHTTFRGHMRMHTGEKPYKCKECGKTFSHPSSFR
NHERTHSGEKPYECKQCGKAFRYYQTFQIHERTHTGEKPYQCKQCGKALSCPTSFRSHER
IHTGEKPYKCKKCGKAFSFPSSFRKHERIHTGEKPYDCKECGKAFISLPSYRRHMIMHTG
NGPYKCKECGKAFDCPSSFQIHERTHTGEKPFECKQCGKAFSCSSSFRMHERTHTGEKPH
ECKQCGKAFSCSSSVRIHERTHTGEKPYECKQCGKAFSCSSSFRMHERIHTGEKPYECKQ
CGKAFSFSSSFRMHERTHTGEKPYECKQCGKAFSCSSSFRMHERTHTGEKPYECKQCGKA
FSCSSSIRIHERTHTGEKPYECKQCGKAFSCSSSVRMHERTHTGEKPYECKQCDKAFSCS
RSFRIHERTHTGEKPYACQQCGKAFKCSRSFRIHERVHSGE
Download sequence
Identical sequences A0A2I3N067 A0A2K5L4S5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]