SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5LCS1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5LCS1
Domain Number 1 Region: 32-246
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.96e-66
Family SPRY domain 0.0000000117
Further Details:      
 
Weak hits

Sequence:  A0A2K5LCS1
Domain Number - Region: 235-272
Classification Level Classification E-value
Superfamily SOCS box-like 0.000288
Family SOCS box-like 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2K5LCS1
Sequence length 273
Comment (tr|A0A2K5LCS1|A0A2K5LCS1_CERAT) SplA/ryanodine receptor domain and SOCS box containing 1 {ECO:0000313|Ensembl:ENSCATP00000010758} KW=Complete proteome; Reference proteome OX=9531 OS=Cercocebus atys (Sooty mangabey) (Cercocebus torquatus atys). GN=SPSB1 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Cercocebus.
Sequence
MGQKVTGGIKTVDMRDPTYRPLKQELQGLDYCKPTRLDLLLDMPPVSYDVQLLHSWNNND
RSLNVFVKEDDKLIFHRHPVAQSTDAIRGKVGYTRGLHVWQITWAMRQRGTHAVVGVATA
DAPLHSVGYTTLVGNNHESWGWDLGRNRLYHDGKNQPSKTYPAFLEPDETFIVPDSFLVA
LDMDDGTLSFIVDGQYMGVAFRGLKGKKLYPVVSAVWGHCEIRMRYLNGLDPEPLPLMDL
CRRSVRLALGKERLGEIHTLPLPASLKAYLLYQ
Download sequence
Identical sequences A0A2I3H020 A0A2I3N993 A0A2J8USB1 A0A2K5E9M2 A0A2K5HB73 A0A2K5LCS1 A0A2K5S079 A0A2K6C1H1 A0A2K6KG20 A0A2K6PYR4 A0A2K6V4L5 F6SE99 F7GGS2 G3R7E8 G7NTE0 H2R2W2 L5KFT4
ENSMMUP00000002747 ENSCJAP00000000716 ENSCJAP00000049120 ENSNLEP00000011295 9544.ENSMMUP00000040619 ENSGGOP00000011284 ENSMMUP00000040619 NP_001244646.1.72884 XP_003274373.1.23891 XP_003822165.1.60992 XP_003927968.1.74449 XP_004024655.1.27298 XP_006914445.1.64745 XP_008998620.1.60252 XP_009446133.1.37143 XP_010362485.1.97406 XP_011380908.1.92234 XP_011380909.1.92234 XP_011735182.1.29376 XP_011735188.1.29376 XP_011735194.1.29376 XP_011735201.1.29376 XP_011735208.1.29376 XP_011791160.1.43180 XP_011904842.1.92194 XP_011904843.1.92194 XP_012329139.1.9421 XP_012353809.1.23891 XP_012353810.1.23891 XP_015002385.1.72884 XP_015298452.1.63531 XP_017358989.1.71028 XP_017358998.1.71028 XP_017711553.1.44346 XP_017829797.1.60252 XP_019495389.1.44202 XP_019495390.1.44202 XP_525174.3.37143 ENSPTRP00000044537 ENSGGOP00000011284 ENSPVAP00000009548 ENSCJAP00000000716 ENSPANP00000004931 ENSPTRP00000044537 ENSPVAP00000009548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]