SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5LL86 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5LL86
Domain Number 1 Region: 499-737
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0000000000000144
Family Protein kinases, catalytic subunit 0.01
Further Details:      
 
Domain Number 2 Region: 44-71
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000249
Family CCCH zinc finger 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2K5LL86
Sequence length 936
Comment (tr|A0A2K5LL86|A0A2K5LL86_CERAT) PAN3 poly(A) specific ribonuclease subunit {ECO:0000313|Ensembl:ENSCATP00000013711} KW=Complete proteome; Reference proteome OX=9531 OS=Cercocebus atys (Sooty mangabey) (Cercocebus torquatus atys). GN=PAN3 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Cercocebus.
Sequence
MNSGGGLPPPSAAASPSSSSLAAAVAVVAPPGVGGVPGGAAVGVKLKYCRYYAKDKTCFY
GEECQFLHEDPAAGAAPGLGLHSNSVPLALAGAPVAGFPPGAVPGGGAGPPPGPKKPDLG
DPGTGAAAGGGGSSGGLDGPRLAIPGMDGGALTDTSLTDSYFSTSFIGVNGFGSPVETKY
PLMQRMTNSSSSPSLLNDSAKPYSGHDPLTSPASSLFNDFGALNISQRRKPRKYRLGMLE
ERLVPMGSKARKAKNPIGCLADRCKSGVPINMVWWNRITENNLQTPNPTASEFIPKGGST
SRLSNVSQSNMSAFSQVFSHPSMGSPATAGLAPGMSLSAGSSPLHSPKITPHTSPAPRRR
SHTPNPASYMVPSSASTSVNNPVSQTPSSGQVIQKETVGGTTYFYTDTTPAPLTGMVFPN
YHIYPPTAPHVAYMQPKANAPSFFMADELRQELINRHLITMAQIDQADMPAVPTEVDSYH
SLFPLEPLPPPNRIQKSSNFGYITSCYKAVNSKDDLPYCLRRIHGFRLVNTKCMVLVDMW
KKIQHSNIVTLREVFTTKAFAEPSLVFAYDFHAGGETMMSRHFNDPNADAYFTKRKWGQH
DGPLPRQHAGLLPESLIWAYIVQLSSALRTIHTAGLACRVMDPTKILITGKTRLRVNCVG
VFDVLTFDNSQNNNPLALMAQYQQADLISLGKVVLALACNSLAGIQRENLQKAMELVTIN
YSSDLKNLILYLLTDQNRMRSVNDIMPMIGARFYTQLDAAQMRNDVIEEDLAKEVQNGRL
FRLLAKLGTINERPEFQKDPTWSETGDRYLLKLFRDHLFHQVTEAGAPWIDLSHIISCLN
KLDAGVPEKISLISRDEKSVLVVTYSDLKRCFENTFQELIAAANALNVLLALGAHHATMK
KMWKLKRSGQTHKHLQLMLLSSILIITHICIFQRSF
Download sequence
Identical sequences A0A2K5LL86

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]