SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5LQQ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5LQQ0
Domain Number 1 Region: 296-358
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.34e-19
Family LIM domain 0.0029
Further Details:      
 
Domain Number 2 Region: 237-299
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.04e-18
Family LIM domain 0.01
Further Details:      
 
Domain Number 3 Region: 355-417
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.15e-16
Family LIM domain 0.0062
Further Details:      
 
Domain Number 4 Region: 414-444
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000931
Family LIM domain 0.01
Further Details:      
 
Domain Number 5 Region: 209-235
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000104
Family LIM domain 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2K5LQQ0
Sequence length 444
Comment (tr|A0A2K5LQQ0|A0A2K5LQQ0_CERAT) Transforming growth factor beta 1 induced transcript 1 {ECO:0000313|Ensembl:ENSCATP00000015263} KW=Complete proteome; Reference proteome OX=9531 OS=Cercocebus atys (Sooty mangabey) (Cercocebus torquatus atys). GN=TGFB1I1 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Cercocebus.
Sequence
MPRSGAPKERPAEPLTPPPSYGHQPQTGSGESSGASGDKDHLYSTVCKPRSPKPAAPAAP
PFSSSSGVLGTGLCELDRLLQELNATQFNITDEIMSQFPSSKVASGEQKEDQSEDKKRPS
LPSSPSPGLPKPSATSATLELDRLMASLSDFRVQNHLPASGPTQPPVASSTNEGSPSPPE
PTGKGSLDTMLGLLQSDLSRRGVPTQAKGLCGSCNKPIAGQVVTALGRAWHPEHFVCGGC
STALGGSSFFEKDGAPFCPECYFERFSPRCGFCNQPIRHKMVTALGTHWHPEHFCCVSCG
EPFGDEGFHEREGRPYCRRDFLQLFAPRCQGCQGPILDNYISALSALWHPDCFVCRECFA
PFSGGSFFEHEGRPLCENHFHARRGSLCATCGLPVTGRCVSALGRRFHPDHFTCTFCLRP
LTKGSFQERAGKPYCQPCFLKLFG
Download sequence
Identical sequences A0A2K5LQQ0 A0A2K5WX04 F6T778
ENSMMUP00000001196 ENSMMUP00000001197 XP_005591809.1.63531 9544.ENSMMUP00000001196 ENSMMUP00000001196

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]