SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5LZM1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5LZM1
Domain Number 1 Region: 4-83
Classification Level Classification E-value
Superfamily F-box domain 2.49e-18
Family F-box domain 0.0028
Further Details:      
 
Domain Number 2 Region: 68-124
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000000000298
Family F-box associated region, FBA 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2K5LZM1
Sequence length 224
Comment (tr|A0A2K5LZM1|A0A2K5LZM1_CERAT) F-box protein 44 {ECO:0000313|Ensembl:ENSCATP00000018397} KW=Complete proteome; Reference proteome OX=9531 OS=Cercocebus atys (Sooty mangabey) (Cercocebus torquatus atys). GN=FBXO44 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Cercocebus.
Sequence
MAVGNINELPENILLELFTHVPARQLLLNCRLVCSLWRDLIDLVTLWKRKCLREGFITED
WDQPVADWKIFYFLRSLHRNLLHNPCAEEGFEFWSLDVNGGDEWKVEDLSRDQRKEFPND
QVRSQARLRVQVPAVRSAPVVRARASGDLPARPGNHPAEERCQVEGGLPHILQLPARRPL
HLVSARRRGHSLLGRLVRPEGHQQQHHHRAPAALTPPEPPSAEP
Download sequence
Identical sequences A0A096N2H7 A0A0D9S8M2 A0A2K5LZM1 A0A2K6A6K2 A0A2K6PU11
XP_007978755.1.81039 XP_007978756.1.81039 XP_007978757.1.81039 XP_010351814.1.97406 XP_010351816.1.97406 XP_010351817.1.97406 XP_011851988.1.47321 XP_011904747.1.92194 XP_011904748.1.92194 XP_011904751.1.92194 XP_011904752.1.92194 XP_011904753.1.92194 ENSPANP00000006521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]