SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5M3J9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5M3J9
Domain Number 1 Region: 2-240
Classification Level Classification E-value
Superfamily L domain-like 8.96e-51
Family Ngr ectodomain-like 0.0065
Further Details:      
 
Domain Number 2 Region: 170-383
Classification Level Classification E-value
Superfamily L domain-like 1.02e-38
Family Ngr ectodomain-like 0.039
Further Details:      
 
Domain Number 3 Region: 448-746
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 2.93e-27
Family Rhodopsin-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2K5M3J9
Sequence length 868
Comment (tr|A0A2K5M3J9|A0A2K5M3J9_CERAT) Leucine rich repeat containing G protein-coupled receptor 6 {ECO:0000313|Ensembl:ENSCATP00000019773} KW=Complete proteome; Reference proteome OX=9531 OS=Cercocebus atys (Sooty mangabey) (Cercocebus torquatus atys). GN=LGR6 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Cercocebus.
Sequence
MNNLTELQPGLFHHLRFLEELRLSGNHLSHIPGQAFSGLYSLKILMLQNNQLGGIPAEAL
WELPSLQSLRLDANLISLVPERSFEGLSSLRHLWLDDNALTEIPVRALNNLPALQAMTLA
LNRISHIPDYAFQNLTSLVVLHLHNNRIQHLGTHSFEGLHNLETLDLNYNELQEFPVAIR
TLGRLQELGFHNNNIKAIPEKAFMGNPLLQTIHFYDNPIQFVGRSAFQYLPKLHTLSLNG
ATDIQEFPDLKGTTSLEILELSHNQIEELPSLHRCQKLEEIGLQHNRIWEIGADTFRQLS
SLQALDLSWNAIRSIHPEAFSTLRSLVKLDLTDNQLTTLPLAGLGGLMHLKLKGNMALSQ
AFSKDSFPKLRILEVPYAYQCCPYGMCPSFFKASGQWEAEDLHLDDEESSKRPLGLLSRQ
AENHYDLDLDELQLEMEDSKPHPSVQCSPIPGPFKPCEHLFESWGIRLAVWAIVLLSVLC
NGLVLLTVFAGGPVPLPPVKFVVGAIAGANTLTGISCGLLASVDALTFGQFSEYGARWEM
GLGCRVTGFLAVLGSEASVLLLTLAAVQCSVSVSCVRAYGKSPSLGSVRAGVLGCLALAG
LAAALPLASVGEYGASPLCLPYAPPEGQPAALGFAVALVMMNSFCFLVVAGAYIKLYCDL
PRGDFEAVWDCAMVRHVAWLIFADGLLYCPVAFLSFASMLGLLPVTPEAVKSVLLVVLPL
PACLNPLLYLLFNPHFRDDLRRLRPRAGASGPLAYAAAGELEKSSCDSTQALVALSDVDL
ILEASEVGRPPGLETYGFPSVTLICQQPGAPRLEGSHCVEPEGNHFGNPQPSLDGELLLR
AEGAMPAGGGSSGGGSFRPSGLAFASHV
Download sequence
Identical sequences A0A2K5M3J9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]