SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5MFN1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5MFN1
Domain Number 1 Region: 585-636
Classification Level Classification E-value
Superfamily Eferin C-derminal domain-like 3.92e-16
Family Eferin C-derminal domain-like 0.00026
Further Details:      
 
Domain Number 2 Region: 18-79
Classification Level Classification E-value
Superfamily EF-hand 0.000000016
Family Calmodulin-like 0.018
Further Details:      
 
Weak hits

Sequence:  A0A2K5MFN1
Domain Number - Region: 340-414
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0034
Family Mitotic arrest deficient-like 1, Mad1 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2K5MFN1
Sequence length 637
Comment (tr|A0A2K5MFN1|A0A2K5MFN1_CERAT) RAB11 family interacting protein 4 {ECO:0000313|Ensembl:ENSCATP00000024012} KW=Complete proteome; Reference proteome OX=9531 OS=Cercocebus atys (Sooty mangabey) (Cercocebus torquatus atys). GN=RAB11FIP4 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Cercocebus.
Sequence
MAGGAGWAGAPAALLRSVRRLREVFEVCGRDPDGFLRVERVAALGLRFGQGEEVEKLVKY
LDPNDLGRINFKDFCRGVFAMKGCEELLKDVLSVESAGTLPCAPEIPDCVEQGSEVTGPT
FADGELIPREPGFFPEDEEEAMTLAPPEGPQELDTDSPMESPQSLEGSVGSPAEKDGGLG
GLFLPEDKSLVHTPSMTTSDLSTHSTTSLISNEEQFEDYGEGDDVDCAPSSPCPDDETRT
NVYSDLGSSVSSSAGQTPRKMRHVYNSELLDVYCSQCCKKINLLNDLEARLKNLKANSPN
RKISSTAFGRQLMHSSNFSSSNGSTEDLFRDSIDSCDNDITEKVSFLEKKVTELENDSLT
NGDLKSKLKQENTQLVHRVHELEEMVKDQETTAEQALEEEARRHREAYSKLEREKATEVE
LLNARVQQLEEENTELRTTVTRLKSQTEKLDEERQRMSDRLEDTSLRLKDEMDLYKRMMD
KLRQNRLEFQKEREATQELIEDLRKELEHLQMYKLDCERPGRGRSASSGLGEFNARAREV
ELEHEVKRLKQENYKLRDQNDDLNGQILSLSLYEAKNLFAAQTKAQSLAAEIDTASRDEL
MEALKEQEEINFRLRQYMDKIILAILDHNPSILEIKH
Download sequence
Identical sequences A0A096P3P5 A0A2K5MFN1
ENSPANP00000019970 XP_011923242.1.92194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]