SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5MK64 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5MK64
Domain Number 1 Region: 10-273
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-91
Family Protein kinases, catalytic subunit 0.00000207
Further Details:      
 
Domain Number 2 Region: 340-470
Classification Level Classification E-value
Superfamily NTF2-like 1.45e-43
Family Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A 0.00000067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2K5MK64
Sequence length 499
Comment (tr|A0A2K5MK64|A0A2K5MK64_CERAT) Calcium/calmodulin dependent protein kinase II delta {ECO:0000313|Ensembl:ENSCATP00000025611} KW=Complete proteome; Reference proteome OX=9531 OS=Cercocebus atys (Sooty mangabey) (Cercocebus torquatus atys). GN=CAMK2D OC=Catarrhini; Cercopithecidae; Cercopithecinae; Cercocebus.
Sequence
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLER
EARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQI
LESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDT
VTPEAKDLINKMLTINPAKRITASEALKHPWICQRSTVASMMHRQETVDCLKKFNARRKL
KGAILTTMLATRNFSAAKSLLKKPDGVKESTESSNTTIEDEDVKARKQEIIKVTEQLIEA
INNGDFEAYTKICDPGLTAFEPEALGNLVEGMDFHRFYFENALSKSNKPIHTIILNPHVH
LVGDDAACIAYIRLTQYMDGSGMPKTMQSEETRVWHRRDGKWQNVHFHRSGSPTVPIKPP
CIPNGKENFSGGTSLWQNI
Download sequence
Identical sequences A0A024RDK3 A0A2J8XPY5 A0A2K5IMP4 A0A2K5MK64 A0A2K5RK61 A0A2K6ED10 A0A2K6KB55 A0A2K6N7K6 A0A2K6S6S1 F7H6E2 G1S2H9 G3RYX1 G7P650 H9ZE08 K7DC81 Q13557 Q6PHZ2
gi|26667180|ref|NP_001212.2| ENSCJAP00000006422 400150 NP_001020609.1.92730 NP_001212.2.87134 NP_001212.2.92137 XP_003269376.1.23891 XP_003830088.1.60992 XP_004040352.1.27298 XP_010338361.1.74449 XP_010379796.1.97406 XP_011747252.1.29376 XP_011803761.1.43180 XP_011884545.1.92194 XP_014994599.1.72884 XP_015306003.1.63531 XP_015340147.1.40921 XP_016807588.1.37143 XP_017703379.1.44346 ENSMUSP00000063359 ENSMMUP00000011271 ENSP00000339740 ENSMMUP00000011271 9544.ENSMMUP00000011271 9598.ENSPTRP00000028140 9606.ENSP00000339740 ENSGGOP00000021012 ENSP00000339740 ENSPTRP00000028142 ENSPTRP00000028142

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]