SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5MNM2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5MNM2
Domain Number 1 Region: 65-188
Classification Level Classification E-value
Superfamily PX domain 2.09e-30
Family PX domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2K5MNM2
Sequence length 315
Comment (tr|A0A2K5MNM2|A0A2K5MNM2_CERAT) Sorting nexin 16 {ECO:0000313|Ensembl:ENSCATP00000026804} KW=Complete proteome; Reference proteome OX=9531 OS=Cercocebus atys (Sooty mangabey) (Cercocebus torquatus atys). GN=SNX16 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Cercocebus.
Sequence
MATPYVPVPMPIGNSASSFTTNRNQRSSSFGSVSTSSNSSKGQLEDANMGAASSIEYSTR
PRETEEQNPETVIWEDRPSTPTILGYEVMEERAKFTVYKILVKKTPEESWVVFRRYTDFS
RLNDKLKEMFPGFRLALPPKRWFKDNYNADFLEDRQLGLQAFLQNLVAHKDIANCLAVRE
FLCLDDPPGPFDSLEESRAFCETLEETNYRLQKELLEKQKEMESLKKLLSEKQLHIDTLE
NRIRTLSVEPEESLDVSETEGEQILKVKSSALEVDQDVLDEESRADNKPCLSFSEPENAV
SEIEVAEVAYDAEED
Download sequence
Identical sequences A0A096N2M2 A0A2K5MNM2 F7CEW2
XP_005563683.1.63531 XP_007999172.1.81039 XP_011887230.1.92194 XP_015001108.1.72884 ENSPANP00000006566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]