SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5MT60 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A2K5MT60
Domain Number - Region: 42-74
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0741
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2K5MT60
Sequence length 199
Comment (tr|A0A2K5MT60|A0A2K5MT60_CERAT) Sjogren syndrome/scleroderma autoantigen 1 {ECO:0000313|Ensembl:ENSCATP00000028391} KW=Complete proteome; Reference proteome OX=9531 OS=Cercocebus atys (Sooty mangabey) (Cercocebus torquatus atys). GN=SSSCA1 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Cercocebus.
Sequence
MALNGAEVDDFSWEPPTEAETKVLQARRERQDRISRLMGDYLLRGYRMLGETCADCGTIL
LQDKQRKIYCVACQELDSDVDKDNPALNAQAALSQAREHQLASASELPLGSRPVPQPPVP
RPEHCEGAAAGLKAAQGPPTPAVPPNTDVMACTQTALLQKLTWASAELGSSTSLETSIQL
CGLIRACAEALRSLQQLQH
Download sequence
Identical sequences A0A096N4G8 A0A2K5K5T6 A0A2K5MT60 A0A2K5W0S1 A0A2K6BVQ0 A0A2K6MYK5 F7GZ32
XP_005577325.1.63531 XP_010375965.1.97406 XP_011719120.1.29376 XP_011897080.1.92194 XP_014969278.1.72884 9544.ENSMMUP00000022572 ENSMMUP00000022572 ENSPANP00000007285 ENSMMUP00000022572

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]