SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5MVZ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5MVZ4
Domain Number 1 Region: 220-282
Classification Level Classification E-value
Superfamily Homeodomain-like 2.01e-20
Family Homeodomain 0.0033
Further Details:      
 
Domain Number 2 Region: 102-168
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000168
Family LIM domain 0.01
Further Details:      
 
Domain Number 3 Region: 71-99
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000101
Family LIM domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2K5MVZ4
Sequence length 356
Comment (tr|A0A2K5MVZ4|A0A2K5MVZ4_CERAT) LIM homeobox 8 {ECO:0000313|Ensembl:ENSCATP00000029361} KW=Complete proteome; Reference proteome OX=9531 OS=Cercocebus atys (Sooty mangabey) (Cercocebus torquatus atys). GN=LHX8 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Cercocebus.
Sequence
MQVLSSCQGLMSEECGRTTALAAGRTRKGAGEEGLVSPEGAGDEDSCSSSAPLSPSSSPR
SMASGSGCPPGKCVCNSCGLEIVDKYLLKVNDLCWHVRCLSCSVCRTSLGRHTSCYIKDK
DIFCKLDYFRRYGTRCSRCGRHIHSTDWVRRAKGNVYHLACFACFSCKRQLSTGEEFALV
EEKVLCRVHYDCMLDNLKREVENGNGISVEGALLTEQDVNHPKPAKRARTSFTADQLQVM
QAQFAQDNNPDAQTLQKLAERTGLSRRVIQVWFQNCRARHKKHVSPNHSSSTPVTAVPPS
RLSPPMLEEMAYSAYVPQDGTMLTALHSYMDAHSPTALGLQPLLPHSMTQLPISHT
Download sequence
Identical sequences A0A2I3MED6 A0A2K5MVZ4 A0A2K6AY93
9544.ENSMMUP00000006987 XP_001097664.2.72884 XP_011741172.1.29376 XP_011937601.1.92194 ENSMMUP00000006987 ENSMMUP00000006987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]