SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5N2F5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5N2F5
Domain Number 1 Region: 432-645
Classification Level Classification E-value
Superfamily TPR-like 7.4e-33
Family Tetratricopeptide repeat (TPR) 0.0021
Further Details:      
 
Domain Number 2 Region: 660-801
Classification Level Classification E-value
Superfamily TPR-like 4.61e-22
Family Tetratricopeptide repeat (TPR) 0.0079
Further Details:      
 
Weak hits

Sequence:  A0A2K5N2F5
Domain Number - Region: 179-248
Classification Level Classification E-value
Superfamily SIS domain 0.0296
Family mono-SIS domain 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2K5N2F5
Sequence length 914
Comment (tr|A0A2K5N2F5|A0A2K5N2F5_CERAT) Transmembrane and tetratricopeptide repeat containing 3 {ECO:0000313|Ensembl:ENSCATP00000031505} KW=Complete proteome; Reference proteome OX=9531 OS=Cercocebus atys (Sooty mangabey) (Cercocebus torquatus atys). GN=TMTC3 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Cercocebus.
Sequence
MADINLKEITLIVGVVAACYWNSLFCGFVFDDVSAILDNKDLHPSTPLKTLFQNDFWGTP
MSEERSHKSYRPLTVLTFRLNYLLSELKPMSYHLLNMIFHAVVSVIFLKVCRLFLDNKSS
VIASLLFAVHPIHTEAVTGVVGRAELLSSIFFLAAFLSYTRSKGPDNSIVWTPIALTVFL
VAVATLCKEQGITVVGICCVYEVFIAQGYTLPLLCTTAGQFLRGKGSIPFSMLQTLVKLI
VLMFSTLLLVVIRVQVIQSQLPVFTRFDNPAAVSPTPTRQLTFNYLLPVNAWLLLNPSEL
CCDWTMGTIPLIESLLDIRNLATFTFFCFLGTLGVFSLRYSGDSSKTVLMALCLMALPFI
PASNLFFPVGFVVAERVLYVPSMGFCILVAHGWQKISTKSVFKKLSWICLSMVILTHSLK
TFHRNWDWESEYTLFMSALKVNKNNAKLWNNVGHALENEKNFERALKYFLQATHVQPDDI
GAHMNVGRTYKNLNRTKEAEESYMMAKSLMPQIIPGKKYAARIAPNHLNVYINLANLIRA
NESRLEEADQLYRQAISMRPDFKQAYISRGELLLKMNKPLKAKEAYLKALELDRNNADLW
YNLAIVYIELKEPNEALKNFNRALELNPKHKLALFNSAILMQESGEVKLRPEARKRLLSY
INEEPLDANGYFNLGMLAMDDKKDNEAEVWMKKAIKLQADFRSALFNLALLYSQTSKELK
ALPILEELLRYYPDHIKGLILKGDILMNQKKDILGAKKCFERILEMDPSNVQGKHNLCVV
YFEEKDLLKAERCLLETLALAPHEEYIQRHLNIVRDKISSSSFIQPIFPTSKISSVEGQK
IPTESVKESRGESRQTQIVKTSDNKSQSKSNKQLGKDRDEETPHKTTKDIKEIEKKRVAA
LKRLEEIERILNGE
Download sequence
Identical sequences A0A096NC38 A0A2K5N2F5
ENSPANP00000010352 XP_011939669.1.92194 XP_011939670.1.92194 XP_011939671.1.92194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]