SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5N3P2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5N3P2
Domain Number 1 Region: 106-141
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000000235
Family CCCH zinc finger 0.00023
Further Details:      
 
Domain Number 2 Region: 144-175
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000000124
Family CCCH zinc finger 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2K5N3P2
Sequence length 332
Comment (tr|A0A2K5N3P2|A0A2K5N3P2_CERAT) ZFP36 ring finger protein {ECO:0000313|Ensembl:ENSCATP00000032123} KW=Complete proteome; Reference proteome OX=9531 OS=Cercocebus atys (Sooty mangabey) (Cercocebus torquatus atys). GN=ZFP36 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Cercocebus.
Sequence
MANRYTMDLTAIYESLLSLSPDVPVPSDHGGTESSPGWGSSGLWSLSPSDSSPSGVTSRL
PGRSTSLVEGRSCGWVPPPPGFAPLAPRLGPELSPSPTSPTATSTTPSRYKTELCRTFSE
SGRCRYGAKCQFAHGLGELRQANRHPKYKTELCHKFYLQGRCPYGSRCHFIHNPSEDLAA
PGHPPVLRQSISFSGLPSGRRTSPPPPGLVGPSLSSSSFSPSSSPPPPGDLPLSPSAFSA
APGTPVARRDPSPLCCPSCRRATPVSVWGPLGGLVRTPSVQSLGSDPDEYASSGSSLGGS
DSPVFEAGVFAPPQPAAAPRRLPIFNRISVSE
Download sequence
Identical sequences A0A0A0MVT7 A0A0D9QV37 A0A1D5Q4Y1 A0A2K5N3P2
ENSPANP00000007806 XP_007994955.1.81039 XP_011933307.1.92194 XP_014979390.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]