SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5N664 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5N664
Domain Number 1 Region: 1123-1298
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.04e-40
Family BCR-homology GTPase activation domain (BH-domain) 0.00059
Further Details:      
 
Domain Number 2 Region: 685-800
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 9.94e-36
Family Pyk2-associated protein beta ARF-GAP domain 0.0015
Further Details:      
 
Domain Number 3 Region: 877-1038
Classification Level Classification E-value
Superfamily PH domain-like 3.67e-24
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 
Domain Number 4 Region: 450-572
Classification Level Classification E-value
Superfamily PH domain-like 4.37e-24
Family Pleckstrin-homology domain (PH domain) 0.0000113
Further Details:      
 
Domain Number 5 Region: 1410-1547
Classification Level Classification E-value
Superfamily PH domain-like 1.8e-19
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 
Domain Number 6 Region: 5-75
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.3e-17
Family SAM (sterile alpha motif) domain 0.0000274
Further Details:      
 
Domain Number 7 Region: 586-678
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000283
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 
Domain Number 8 Region: 1015-1109
Classification Level Classification E-value
Superfamily PH domain-like 0.000000115
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2K5N664
Sequence length 1680
Comment (tr|A0A2K5N664|A0A2K5N664_CERAT) Uncharacterized protein {ECO:0000313|Ensembl:ENSCATP00000032987} KW=Complete proteome; Reference proteome OX=9531 OS=Cercocebus atys (Sooty mangabey) (Cercocebus torquatus atys). GN= OC=Catarrhini; Cercopithecidae; Cercopithecinae; Cercocebus.
Sequence
MSSVSEVNVDIKDFLMSINLEQYLLHFHESGFTTVKDCAAINDSLLQKIGISPTGHRRRI
LKQLQIILSKMQDFPIYANVHKTKKNDDPSKDHNVPSSDQNICVELSSSSSVQMPSPPQL
ETVTKKLEDDASVERSRYPQSDNKLSPPKRDFPTAEEPHLNLGSLNNSLFGSENIKIESL
ITKKTMDHRIEEQQTEKVKLISENLNKLPNADSECLSSVGCSTSETNSRNGTNGLLDGSP
PSPFFKFQGEMIVNDLYVPSSPILAPMRSRSKLVSRPSRSFLLRHRPVPEIPGSTKGISG
SYFRERRNVATSTEKSVAWQISNEENSSSIFPYGETFLFQRLENSKKRSIKNEFLTQEEA
LKGEATTATNSFIIKSSIYDNRKEKISEDKVEDIWIPREDKNNFLIDTASESEYSTVEEC
FQSLRRKNSKASKSRTQKALTLDSVNRHSYPLSSTSGNADSSAVSSQAISPYACFYGASV
KKVKSGWLDKLSPQGKRMFQKRWVKFDGLSISYYNNEKEMYSKGIIPLSAISTVRVQGDN
KFEVVTTQRTFVFRVEKEEERNDWISILLNALKSQSLTSQSQGVVTPEKCGYLELRGYKA
KIFTVLSGNSVWLCKNEQDFKSGLGITIIPMNVANVKQVDRTVKQSFEIITPYRSFSFTA
ETEKEKQDWIEAVQQSIAETLSDYEVAEKIWFNESNRSCADCKAPDPDWASINLCVVICK
KCAGQHRSLGPKDSKVRSLKMDASIWSNELIELFIVIGNKRANDFWAGNLQKDEELHMDS
PVEKRKNFITQKYKEGKFRKTLLASLTKEELNKALCAAVVKPDVLETMALLFSGADVMCA
TGDPVHSTPYLLAKKAGQSLQMEFLYHNKFSDFPQHDIHSEGVLSQESSQSTFLCDFLYQ
APSAASKLSSEKKLLEETNKKWCVLEGGFLSYYESDKSTTPNGTININEVICLAIHKEDF
YLNTGPIFIFEIYLPSERVFLFGAETSQAQRKWTEAIAKHFVPLFAENLTEADYDLIGQL
FYKDCHALDQWRKGWFAMDKSSLHFCLQMQEVQGDRMHLRRLQELTISTVVQNGEKLDVL
LLVEKGRTLYIHGHTKLDFTVWHTAIEKAAGTDGNALQDQQLSKNDVPIIVNSCIAFVTQ
YGLGCKYIYQKNGDPLHISELLESFKKDARSFKLRAGKHQLEDVTGVLKSFLSDIDDALL
TKELYPYWISALDAQDDKERIKKYGAFIRSLPGVNRATLAAIIEHLYRVQKCSEINHMNA
HNLALVFSSCLFQTKGQTSEEVNVIEDLINNYVEIFEVSQAGDLLIEVYVERKEPDCSII
IRISPVMEAEELTNDILAIKNIIPTKGDIWATFEVIENEELERPLHYKENVLEQVLRWSS
LAEPGSAYLVVKKFLTADTIKHCSDRSTLGSIKEGILKIKEEPSKILSGNKFQDRYFVLR
DGFLFLYKDVKSSKHDKMFSLSSVKFYRGVKKKMKPPTSWGLTAYSEKHHWHLCCDSSRT
QTEWMTSIFIAQHENDIWPPAGKERKRSITKNPKIGGLPLIPIQHEGNATLARKNIESAR
AELERLRLIEKCDKESVDSSLKERASMVAHCLEHKDDKLRNRTRKHRSFNCLEDTEPEAL
LGQPKGHKGLKTLRKTEDRNSKATLDSDHKLPSRVIEELNVVLQRSRTLPRELQDEQILK
Download sequence
Identical sequences A0A2K5N664
XP_011913389.1.92194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]