SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5NC69 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A2K5NC69
Domain Number - Region: 178-202
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0034
Family CCCH zinc finger 0.0032
Further Details:      
 
Domain Number - Region: 13-41
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0089
Family CCCH zinc finger 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2K5NC69
Sequence length 373
Comment (tr|A0A2K5NC69|A0A2K5NC69_CERAT) Muscleblind like splicing regulator 2 {ECO:0000313|Ensembl:ENSCATP00000035064} KW=Complete proteome; Reference proteome OX=9531 OS=Cercocebus atys (Sooty mangabey) (Cercocebus torquatus atys). GN=MBNL2 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Cercocebus.
Sequence
MALNVAPVRDTKWLTLEVCRQFQRGTCSRSDEECKFAHPPKSCQVENGRVIACFDSLKGR
CSRENCKYLHPPTHLKTQLEINGRNNLIQQKTAAAMLAQQMQFMFPGTPLHPVPTFPVGP
AIGTNTAISFAPYLAPVTPGVGLVPTEILPTTPVIVPGSPPVTVPGSTATQKLLRTDKLE
VCREFQRGNCARGETDCRFAHPADSTMIDTSDNTVTVCMDYIKGRCMREKCKYFHPPAHL
QAKIKAAQHQANQAAVAAQAAAAAATVMAFPPGALHPLPKRQALEKSNGTSAVFNPSVLH
YQQALTSAQLQQHAAFIPTGSVLCMTPATSIDNSEIISRNGMECQESALRITKHCYCTYY
PVSSSIELPQTAC
Download sequence
Identical sequences A0A2I2Z8Y8 A0A2I3FUH2 A0A2I3LGJ2 A0A2J8M935 A0A2J8X8L4 A0A2K5EME0 A0A2K5ILS7 A0A2K5NC69 A0A2K5S867 A0A2K5YAM8 A0A2K6E7E7 F6UL98 G7NJI6 G7PVM0 Q5R4F5 Q5VZF2
ENSGGOP00000008158 NP_001292999.1.87134 NP_001292999.1.92137 XP_001141054.1.37143 XP_003832083.1.60992 XP_003928258.1.74449 XP_004088205.1.23891 XP_007958907.1.81039 XP_011732461.1.29376 XP_011789196.1.43180 XP_011826051.1.47321 XP_011890842.1.92194 XP_012314053.1.9421 XP_016875798.1.92137 XP_017385540.1.71028 XP_017825542.1.60252 ENSCJAP00000007802 ENSPTRP00000056966 ENSP00000365861 ENSPTRP00000056966 ENSP00000404202 9598.ENSPTRP00000056966 ENSP00000365861 ENSGGOP00000008158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]