SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5NJV2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5NJV2
Domain Number 1 Region: 253-368
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.3e-34
Family UBX domain 0.00000171
Further Details:      
 
Domain Number 2 Region: 174-269
Classification Level Classification E-value
Superfamily NSFL1 (p97 ATPase) cofactor p47, SEP domain 1.24e-33
Family NSFL1 (p97 ATPase) cofactor p47, SEP domain 0.00000163
Further Details:      
 
Domain Number 3 Region: 1-46
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000034
Family TAP-C domain-like 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2K5NJV2
Sequence length 370
Comment (tr|A0A2K5NJV2|A0A2K5NJV2_CERAT) NSFL1 cofactor {ECO:0000313|Ensembl:ENSCATP00000037732} KW=Complete proteome; Reference proteome OX=9531 OS=Cercocebus atys (Sooty mangabey) (Cercocebus torquatus atys). GN=NSFL1C OC=Catarrhini; Cercopithecidae; Cercopithecinae; Cercocebus.
Sequence
MAAERQEALREFVAVTGAEEERARFFLESAGWDLQIALASFYEDGGDEDIVTISQATPSS
VSRGTAPSDNRVTSFRDLIHDQDEDEEEEEGQRFYAGGSERSGQQIVGPPRKKSPNELVD
DLFKGAKEHGAVAVERVTKSPGETSKPRPFAGGGYRLGAAPEEESAYVAGEKRQHSSQDV
HVVLKLWKSGFSLDNGELRSYQDPSNAQFLESIRRGEVPAELRRLAHGGQVNLDMEDHRD
EDFVKPKGAFKAFTGEGQKLGSTAPQVLSTSSPAQQAENEAKASSSILIDESEPTTNIQI
RLADGGRLVQKFNHSHRISDIRLFIVDARPAMAATSFILMTTFPNKELADESQTLKEANL
LNAVIVQRLT
Download sequence
Identical sequences A0A096NV55 A0A2K5NJV2 A0A2K5VJS2 A0A2K6D0W9 I0FG44
ENSPANP00000016930 NP_001253592.1.72884 XP_005568608.1.63531 XP_011764512.1.29376 XP_011907729.1.92194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]