SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5P1A2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5P1A2
Domain Number 1 Region: 269-550
Classification Level Classification E-value
Superfamily Kelch motif 3.4e-79
Family Kelch motif 0.00000145
Further Details:      
 
Domain Number 2 Region: 5-113
Classification Level Classification E-value
Superfamily POZ domain 7.46e-34
Family BTB/POZ domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2K5P1A2
Sequence length 555
Comment (tr|A0A2K5P1A2|A0A2K5P1A2_CERAT) Kelch like family member 3 {ECO:0000313|Ensembl:ENSCATP00000043416} KW=Complete proteome; Reference proteome OX=9531 OS=Cercocebus atys (Sooty mangabey) (Cercocebus torquatus atys). GN=KLHL3 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Cercocebus.
Sequence
MGKAFKVMNELRSKQLLCDVMIVAEDVEIEAHRVVLAACSPYFCAMFTGDMSESKAKKIE
IKDVDGQTLSKLIDYIYTAEIEVTEENVQVLLPAASLLQLMDVRQNCCDFLQSQLHPTNC
LGIRAFADVHTCTDLLQQANAYAEQHFPEVMLGEEFLSLSLDQVCSLISSDKLTVSSEEK
VFEAVISWINYEKETRLEHMAKLMEHVRLPLLPRDYLVQTVEEETLIKNNNTCKDFLIEA
MKYHLLPLDQRLLIKNPRTKPRTPVSLPKVMIVVGGQAPKAIRSVECYDFEEDRWDQIAE
LPSRRCRAGVVFMAGHVYAVGGFNGSLRVRTVDVYDGVKDQWTSIASMQERRSTLGAAVL
NDLLYAVGGFDGSTGLASVEAYSYKTNEWFFVAPMNTRRSSVGVGVVEGKLYAVGGYDGA
SRQCLSTVEQYNPATNEWTYVADMSTRRSGAGVGVLSGQLYATGGHDGPLVRKSVEVYDP
GTNTWKQVADMNMCRRNAGVCAVNGLLYVVGGDDGSCNLASVEYYNPVTDKWTLLPTNMS
TGRSYAGVAVIHKSL
Download sequence
Identical sequences A0A2K5P1A2 A0A2K6A682 G7MUF1 G7P8C9
ENSMMUP00000015644 9544.ENSMMUP00000015644 ENSMMUP00000015644 XP_011714777.1.29376 XP_011824558.1.47321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]