SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5P5W2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5P5W2
Domain Number 1 Region: 213-342
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 1.09e-29
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000135
Further Details:      
 
Domain Number 2 Region: 35-119
Classification Level Classification E-value
Superfamily PH domain-like 4.92e-21
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.00061
Further Details:      
 
Domain Number 3 Region: 402-462
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00000000000112
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2K5P5W2
Sequence length 474
Comment (tr|A0A2K5P5W2|A0A2K5P5W2_CERAT) Uncharacterized protein {ECO:0000313|Ensembl:ENSCATP00000045052} KW=Complete proteome; Reference proteome OX=9531 OS=Cercocebus atys (Sooty mangabey) (Cercocebus torquatus atys). GN= OC=Catarrhini; Cercopithecidae; Cercopithecinae; Cercocebus.
Sequence
MSGGPMGGRPGGRGAPAVQQNIPSTLLQDHENQRLFEMLGRKCLTLATAVVQLYLALPPG
AEHWTKEHCGAVCFVKDNPQKSYFIRLYGLQDCQAGLNFADEGEAQAFRALVQEKIQKRN
QRQSGDRRQLLPPPPPANEERRGGLPPLPPHPGGDQGGPPVGPLSLGLATVDIQNPDITS
SRYRGLPAPGPSPADKKRSGKKKISKADIGAPSGFKHVTHVGWDPQNGFDVNNLDPDLRS
LFSRAGISEAQLTDAETSKLIYDFIEDQGGLEAVRQEMRRQEPLPPPPPPSRGGNQPPRP
PIVGGNKGRSGPLPPVPLGVAPPPPTPRGPPPPGRGGPLPPPPPATGRSGPPPPPPPGAG
GPPMPPPPPPPPPPPPSSGNGPAPPLLPPALVPAGGLAPGGGRGALLDQIRQGIQLNKTP
GAPESSALQPPPQSSEGLVGALMHVMQKRSRAIHSSDEGEDQAGDEDEDDEWDD
Download sequence
Identical sequences A0A2K5P5W2
XP_015299071.1.63531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]