SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5PBM0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5PBM0
Domain Number 1 Region: 438-567
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000549
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 2 Region: 629-671
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000104
Family EGF-type module 0.0051
Further Details:      
 
Domain Number 3 Region: 731-857
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000392
Family Growth factor receptor domain 0.0072
Further Details:      
 
Domain Number 4 Region: 663-704
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000485
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 5 Region: 374-416
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000628
Family EGF-type module 0.01
Further Details:      
 
Domain Number 6 Region: 338-378
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000205
Family EGF-type module 0.012
Further Details:      
 
Domain Number 7 Region: 297-341
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000504
Family EGF-type module 0.012
Further Details:      
 
Domain Number 8 Region: 708-742
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000016
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2K5PBM0
Sequence length 1218
Comment (tr|A0A2K5PBM0|A0A2K5PBM0_CEBCA) Jagged 1 {ECO:0000313|Ensembl:ENSCCAP00000001030} KW=Complete proteome OX=1737458 OS=Cebus capucinus imitator. GN=JAG1 OC=Platyrrhini; Cebidae; Cebinae; Cebus.
Sequence
MRSPRARGRPGRPLSLLLALLCTLRAKVCGAAGQFEWELLSMQNVNGELQNGNCCGGARN
PGDRKCTRDECDTYFKVCLKEYQSRVTAGGPCSFGQGSTPVIGGNTFTFKAGRANDRNRI
VLPFSFAWPRSYTLLVEAWDSSNNTLRPDNIIEKASHSGMINPSRQWQTLKQNTGIAHFE
YQIRVTCDDYYYGFGCNKFCRPRDDFFGHYTCDQNGNKTCMEGWMGSECNRAICRQGCST
KHGSCKHPGDCRCQYGWQGLYCDKCIPHPGCVHGICIEPWQCLCETNWGGQLCDKDLNYC
GTHQPCLNGGACSNTGPDKYQCSCPEGYSGVSCEIAEHACLSDPCHNRGSCKETSLGFEC
ECSPGWTGPTCSTNIDDCSPNNCSHGGTCQDLVNGFKCVCPPQWTGKTCQLDANECEAKP
CVNAKSCKNLIASYYCDCLPGWMGQNCDININDCLGQCQNDASCQDLVNGYRCICPPGYA
GDHCERDIDECASNPCLNGGHCQNEINRFQCLCPTGFSGNLCQLDIDYCEPNPCQNGAQC
YNRASDYFCKCPEDYEGKNCSHLKDHCRTTPCEVIDSCTVAMASNDTPEGVRYISSNVCG
PHGKCKSQSGGKFTCDCNKGFMGTYCHENINDCESNPCKNGGTCIDGVNSYKCICSDGWE
GAYCETNINDCSQNPCHNGGTCRDLVNDFYCDCKNGWKGKTCHSRDSQCDEATCNNGGTC
YDEGDAFKCMCPGGWEGTTCNIARNSSCLPNPCHNGGTCVVNGESFTCVCKEGWEGPICT
QNTNDCSPHPCYNSGTCVDGDNWYRCECAPGFAGPDCRININECQSSPCAFGATCVDEIN
GYRCVCPPGHSGAKCQEVSGRPCITMGSVIPDGAKWDDDCNTCQCLNGRIACSKVWCGPR
PCLLHKGHSECPSGQSCIPILDDQCFVRPCTGVGECRSSGLQPVKTKCTSDAYYQDNCAN
ITFTFNKEMMSPGLTTEHICSELRNLNILKNVSAEYSIYIACEPSPSANNEIHVAISAED
IRDDGNPVKEITDKIIDLVSKRDGNSSLIAAVAEVRVQRQPQKNRTDFLVPLLSSVLTVA
WICCLATALYWCLRKRRKPGSHTHSASEDNTTNNVREQLNQIKNPIEKHGANTVPIKDYE
NKNSKMSKIRTHNSEVEEDDMDKHQQKARFAKQPAYTLVDREEKPPNSTPTKHPNWTNKQ
DNRDLESAQSLNRMEYIV
Download sequence
Identical sequences A0A2K5PBM0
XP_017379423.1.71028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]