SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5QST9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5QST9
Domain Number 1 Region: 280-337
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.2e-23
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 2 Region: 476-533
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.57e-23
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 3 Region: 198-253
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.27e-23
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 4 Region: 336-393
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.15e-22
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 5 Region: 420-477
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.21e-22
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 6 Region: 108-169
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.79e-21
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 7 Region: 2-57
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.45e-20
Family KRAB domain (Kruppel-associated box) 0.00052
Further Details:      
 
Domain Number 8 Region: 522-574
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.2e-17
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 9 Region: 383-415
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000341
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 10 Region: 159-191
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000274
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 11 Region: 243-275
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000434
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 12 Region: 78-122
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000086
Family Classic zinc finger, C2H2 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2K5QST9
Sequence length 576
Comment (tr|A0A2K5QST9|A0A2K5QST9_CEBCA) Zinc finger protein 791 {ECO:0000313|Ensembl:ENSCCAP00000018973} KW=Complete proteome OX=1737458 OS=Cebus capucinus imitator. GN=ZNF791 OC=Platyrrhini; Cebidae; Cebinae; Cebus.
Sequence
MDSVAFEDVSVNFSQEEWALLAPSQKKLYRDVMQETFKNLASIGKKWEDQNVEDRHKNQG
KNLRSHMVERLCESKEGSQCGETFSSSLCVTKKTARVKLDECTVCGKVFMRRSSLTRHMR
SHTGYELIEKPYKCKECGKAFSYLKSFQRHERSHTGEKPYKCKQCGKTFIYHQPFQTHER
THIGEKPYECKQCGKALSCPSSLRIHERIHTGEKPYECKKCGKAFSCPSSIRIHERTHTG
EKPYACKECGKAFISHTSVLTHMITHNGDRPYKCKECGKAFIFPSFLRVHERIHTGEKPY
KCKQCGKAFRCSTSIQIHERTHTGEKPYKCKECGKSFTARPAFRVHLRVHTGEKPYKCKE
CGKAFSRTSYFRIHERTHTGEKPYECKKCGKTFNYPLDLQIHERNHTGEKPYECKECAKA
FISLENFRRHMITHTGDGPYKCRDCGKAFIFPSALRTHERTHTGEKPFECKQCGKAFSCS
SYIQIHERTHTGEKPYECKECGKAFIYPTSFQGHMRMHTGEKPYKCKECGKAFSLHSSFQ
RHERIHSCEKPLECKQCGKGFSLSTSLQKHMRMHTR
Download sequence
Identical sequences A0A2K5QST9
XP_017353328.1.71028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]