SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5R3A5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5R3A5
Domain Number 1 Region: 4-150
Classification Level Classification E-value
Superfamily E set domains 4.08e-56
Family RhoGDI-like 0.0000000567
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2K5R3A5
Sequence length 150
Comment (tr|A0A2K5R3A5|A0A2K5R3A5_CEBCA) Uncharacterized protein {ECO:0000313|Ensembl:ENSCCAP00000022590} KW=Complete proteome OX=1737458 OS=Cebus capucinus imitator. GN= OC=Platyrrhini; Cebidae; Cebinae; Cebus.
Sequence
MSAKDERAREILRGFKLNWMNLRDAETGKILWQGTEDLSVPGVEHEARVPKKILKCKAVS
RELNFSSTEQMEKFRLEQKVYFKGQCLEEWFFEFGFVIPNSTNTWQSLIEAAPESQMMPA
SVLTGNVIIETKFFDDDLLVSTSRVRLFYV
Download sequence
Identical sequences A0A2K5C118 A0A2K5R3A5 A0A2K6NXU1 A0A2K6TJP9 G3RCF1 H2P8W8 H2QJL5 O43924 Q6IB24
ENSP00000287600 ENSPPYP00000014835 gi|4505671|ref|NP_002592.1| ENSP00000287600 ENSGGOP00000013177 ENSPTRP00000022277 ENSGGOP00000013177 NP_002592.1.87134 NP_002592.1.92137 XP_001144711.1.37143 XP_002813030.1.23681 XP_003821919.1.60992 XP_003930656.1.74449 XP_004033399.2.27298 XP_010352877.1.97406 XP_012289561.1.9421 XP_017372024.1.71028 ENSPTRP00000022277 001893696|e5tb5B1|11.1.1.95|B:1-150 002073905|e5nalB1|11.1.1.95|B:1-150 d5nalb_ d5tb5b_ ENSPPYP00000014835 5nal_B 5tb5_B 5tb5_D 5x72_A 5x73_A 5yav_B 5yaw_B ENSP00000287600 9598.ENSPTRP00000022277 9600.ENSPPYP00000014835 9606.ENSP00000287600

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]