SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5R7N6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5R7N6
Domain Number 1 Region: 524-893
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 3.4e-128
Family Hect, E3 ligase catalytic domain 0.00000000388
Further Details:      
 
Domain Number 2 Region: 20-157
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.71e-29
Family PLC-like (P variant) 0.093
Further Details:      
 
Domain Number 3 Region: 469-509
Classification Level Classification E-value
Superfamily WW domain 0.0000000000000262
Family WW domain 0.00012
Further Details:      
 
Domain Number 4 Region: 183-225
Classification Level Classification E-value
Superfamily WW domain 0.000000000000292
Family WW domain 0.0011
Further Details:      
 
Domain Number 5 Region: 342-382
Classification Level Classification E-value
Superfamily WW domain 0.000000000000515
Family WW domain 0.0018
Further Details:      
 
Domain Number 6 Region: 418-455
Classification Level Classification E-value
Superfamily WW domain 0.00000000000153
Family WW domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2K5R7N6
Sequence length 900
Comment (tr|A0A2K5R7N6|A0A2K5R7N6_CEBCA) Neural precursor cell expressed, developmentally down-regulated 4, E3 ubiquitin protein ligase {ECO:0000313|Ensembl:ENSCCAP00000024146} KW=Complete proteome OX=1737458 OS=Cebus capucinus imitator. GN=NEDD4 OC=Platyrrhini; Cebidae; Cebinae; Cebus.
Sequence
MATCAVEVFGLLEDEENSRIVRVKVIAGIGLAKKDILGASDPYVRVTLYDPMNGVLTSVQ
TKTIKKSLNPKWNEEILFRVHPQQHRLLFEVFDENRLTRDDFLGQVDVPLYPLPTENPRM
ERPYTFKDFVLHPRSHKSRVKGYLRLKMTYLPKTNGSEDDNAEQAEELEPGWVVLDQPDA
ACHLQQQREPSPLPPGWEERQDILGRTYYVNHESRRTQWKRPTPQDNLTDAENGNIQLQA
QRAFTTRRQISEETESVDNRESSENWEIIREDEATMYSSQAFPSPPPSSNLDVPAHLAEE
LNARLTIFGNSATSQPVSSSNHSSRRGSLQAYTFEEQPTLPVLLPTSSGLPPGWEEKQDE
RGRSYYVDHNSRTTTWTKPTVQATVETNQLTSSQSSAGPQSQASTSDSGQQVTQPSETEQ
GFLPKGWEVRHAPNGRPFFIDHNTKTTTWEDPRLKIPAHLRGKTALDTSSDLGPLPPGWE
ERTHTDGRIFYINHNIKRTQWEDPRLQNVAITGPAVPYSRDYKRKYEFFRRKLKKQNDIP
NKFEMKLRRATVLEDSYRRIMGVKRADFLKARLWIEFDGEKGLDYGGVAREWFFLISKEM
FNPYYGLFEYSATDNYTLQINPNSGLCNEDHLSYFKFIGRVAGMAVYHGKLLDGFFIRPF
YKMMLHKPITLHDMESVDSEYYNSLRWILENDPTELDLRFIIDEELFGQTHQHELKNGGS
EIVVTNKNKKEYIYLVIQWRFVNRIQKQMAAFKEGFFELIPQDLIKIFDENELELLMCGL
GDVDVNDWREHTKYKNGYSANHQVIQWFWKAVLMMDSEKRIRLLQFVTGTSRVPMNGFAE
LYGSNGPQLFTVEQWGTPEKLPRAHTCFNRLDLPPYESFEELWDKLQMAIENTQGFDGVD
Download sequence
Identical sequences A0A2K5R7N6
XP_017398871.1.71028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]