SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5R981 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5R981
Domain Number 1 Region: 34-125
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 5.04e-38
Family SCAN domain 0.0000409
Further Details:      
 
Domain Number 2 Region: 471-527
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.58e-24
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 3 Region: 583-640
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.72e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 4 Region: 629-681
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.27e-18
Family Classic zinc finger, C2H2 0.0023
Further Details:      
 
Domain Number 5 Region: 433-484
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.12e-17
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 6 Region: 512-560
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000205
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 7 Region: 210-265
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000000000301
Family KRAB domain (Kruppel-associated box) 0.0044
Further Details:      
 
Domain Number 8 Region: 374-415
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000106
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2K5R981
Sequence length 683
Comment (tr|A0A2K5R981|A0A2K5R981_CEBCA) Zinc finger protein 263 {ECO:0000313|Ensembl:ENSCCAP00000024698} KW=Complete proteome OX=1737458 OS=Cebus capucinus imitator. GN=ZNF263 OC=Platyrrhini; Cebidae; Cebinae; Cebus.
Sequence
MTLVPGSQEREGLLIVKLEEDCAWSPELPPPDPGPSPEASHLRFRRFRFQEAAGPREALS
RLQELCHGWLRPEMRTKEQILELLVLEQFLTILPQEIQSRVQELHPESGEEAVTLVEDMQ
RELGRLRQQVTNHGRGTEVLLEETLPLGTARESPSFKLEPLETERSPGPRLQELLGPSPQ
RDPQAVKERALSAPWLSLFPPEGNMEDKMTGPQLPESLEDVAMYISQEEWGHQDPSKRAL
SRDTVQESYENVDSLESHIPSQEVPSTQVGQGGKLWDPSVQSCKEGLNPRGPVPGEEKFE
NLEEGVPSVSPENTHPQVLLPDQVRGEVPWSTELGRPHDRPQGDWAPPPEGGMEQSSAGA
SSSRELGRPKELQPKKLHLCPLCGKNFSNNSNLIRHQRIHAAERLCLGVDCSEIFGGNPR
FLSLHRAHLGEEAHKCLECGKCFSQNTHLTRHQRTHTGEKPYQCNICGKCFSCNSNLHRH
QRTHTGEKPYKCPECGEIFAHSSNLLRHQRIHTGERPYKCHECGKSFSRSSHLVIHERTH
EKERLYPFSECGEAVSDSTSFLTNHGARKAEKKLFECLTCGKSFRQGMHLTRHQRTHTGE
KPYKCTLCGENFSHRSNLIRHQRIHTGEKPYTCHECGDSFSHSSNRIRHLRTHTGERPYK
CSECGESFSRSSRLMSHQRTHTG
Download sequence
Identical sequences A0A2K5R981
XP_017366642.1.71028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]