SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5RB20 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5RB20
Domain Number 1 Region: 431-488
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.47e-24
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 2 Region: 487-544
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.26e-24
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 3 Region: 179-236
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.39e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 4 Region: 543-600
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.04e-22
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 5 Region: 375-432
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.3e-22
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 6 Region: 235-290
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.02e-21
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 7 Region: 2-61
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.24e-21
Family KRAB domain (Kruppel-associated box) 0.00043
Further Details:      
 
Domain Number 8 Region: 294-348
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.35e-21
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 9 Region: 141-193
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.89e-19
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 10 Region: 589-641
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.38e-17
Family Classic zinc finger, C2H2 0.0092
Further Details:      
 
Domain Number 11 Region: 91-152
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000422
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 12 Region: 338-370
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000031
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2K5RB20
Sequence length 644
Comment (tr|A0A2K5RB20|A0A2K5RB20_CEBCA) Uncharacterized protein {ECO:0000313|Ensembl:ENSCCAP00000025323} KW=Complete proteome OX=1737458 OS=Cebus capucinus imitator. GN= OC=Platyrrhini; Cebidae; Cebinae; Cebus.
Sequence
MMFQDSVVFEDVAVNFTQEEWALLGPSQKKLYRDVMQETFVNLASIGENWEDRNIEDHRD
HGRKLRSHMVERLCESKEGNQLGEAISQTPNPKTNRKTFTRVKPYECSVCGKDYMCHSSL
NRHMRSHSEHRSYEYQKYGEKSYECKECGKRFSFRSSFRIHERTHTGEKPYKCKQCGKAF
SWPSSFQIHERTHTGEKPYECKECGKAFIYHTTFRGHMRMHTGEKPYKCKECGKTFSHPS
SFRNHERTHSGEKPYECKQCGKAFRYYQTFQIHERTHTGEKPYQCKQCGKALSCPTSFRS
HERIHTGEKPYKCKKCGKAFSFPSSFRKHERIHTGEKPYDCKECGKAFISLPSYRRHMIM
HTGNGPYKCKECGKAFDCPSSFQIHERTHTGEKPYECKQCGKAFSCSSSFRMHERTHTGE
KPHECKQCGKAFSCSSSVRIHERTHTGEKPYECKQCGKAFSCSSSFRMHERIHTGEKPYE
CKQCGKAFSFSSSFRMHERTHTGEKPYECKQCGKAFSCSSSFRMHERTHTGEKPYECKQC
GKAFSCSSSIRIHERTHTGEKPYECKQCGKAFSCSSSVRMHERTHTGVKPYECKQCDKAF
SCSRSFRIHERTHTGEKPYACQQCGKAFKCSRSFRVHERVHTGE
Download sequence
Identical sequences A0A2K5RB20
XP_017353321.1.71028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]