SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5RGS6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5RGS6
Domain Number 1 Region: 261-318
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.67e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 2 Region: 429-486
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.03e-22
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 3 Region: 373-430
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.78e-22
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 4 Region: 486-542
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.2e-22
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 5 Region: 597-654
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.11e-21
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 6 Region: 205-262
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.21e-21
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 7 Region: 541-598
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.75e-20
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 8 Region: 4-62
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.01e-19
Family KRAB domain (Kruppel-associated box) 0.0016
Further Details:      
 
Domain Number 9 Region: 150-206
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.29e-17
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 10 Region: 644-695
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.68e-17
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 11 Region: 95-151
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.22e-16
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 12 Region: 303-352
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000237
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2K5RGS6
Sequence length 696
Comment (tr|A0A2K5RGS6|A0A2K5RGS6_CEBCA) Uncharacterized protein {ECO:0000313|Ensembl:ENSCCAP00000027332} KW=Complete proteome OX=1737458 OS=Cebus capucinus imitator. GN= OC=Platyrrhini; Cebidae; Cebinae; Cebus.
Sequence
MACRSITFRDVAIDFSLQEWEYLNLVQKTLYQEVMMENYDHLVSLAGHSISKPDLITLLE
QGKEPWMIVREETRGECTDLDSRCEIINDRKMDIYRKHSSVTLHQRIHNGQKPYECKECQ
KAFSHLTELMVHQRIHTSEEPEQREEFGKAFSHFTDLREHQKIHAREKLYECEECGKVFS
YPANLAQHGKVHVEKPYECKECGEAFRTSRQLTVHHRFHYGEKPYECKECGKAFSVYGRL
SRHQSIHTGEKPFECNKCGKTFRLKAGLKVHQSIHTGEKPHECKECGKSFRQFSHLVGHK
RIHTGEKPYECKECGKGFTCRYQLTMHQRIYSGEKPYECKENGEAFSSSHQFTAPHTFES
IEKPFKCEECGKAFSVHGRLTRHQGIHSGKKPFECNKCGKSFRLNSSLKIHQNIHTGEKP
YECKECGKAFSQRAHLAHHNRIHTGYKPFECKECGKSFRCASYLVIHERIHTGEKPYVCQ
ECGKGFSYSHKLTMHRRVHTGEKPYECKECGKAFSVSGQLTQHLSVHSGKKPFECNQCGK
SFRFISVLKAHQNVHSAEKPYECKECGKAFRHATSLIYHDRTHAGEKSYECKECGETFSH
ASHLIIHERIHTGDTPYECKRCGKAFRCSSYLVRHERVHADGNPYMCEECGKAFNSSHEL
SIHHRVHTGEKPFKCNKCRRSFRLRSILEVHQRIHI
Download sequence
Identical sequences A0A2K5RGS6
XP_017361912.1.71028 XP_017361913.1.71028 XP_017361914.1.71028 XP_017361915.1.71028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]