SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5RUS5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5RUS5
Domain Number 1 Region: 50-160
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 4.19e-38
Family Frizzled cysteine-rich domain 0.0000587
Further Details:      
 
Domain Number 2 Region: 177-305
Classification Level Classification E-value
Superfamily TIMP-like 1.1e-23
Family Tissue inhibitor of metalloproteinases, TIMP 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2K5RUS5
Sequence length 315
Comment (tr|A0A2K5RUS5|A0A2K5RUS5_CEBCA) Secreted frizzled related protein 5 {ECO:0000313|Ensembl:ENSCCAP00000031894} KW=Complete proteome OX=1737458 OS=Cebus capucinus imitator. GN=SFRP5 OC=Platyrrhini; Cebidae; Cebinae; Cebus.
Sequence
MRAAAGGARTAALALLLGALRWAPARGEEYDYYGWQAEPLHGRSYSKPPQCLDIPADLPL
CHTVGYKRMRLPNLLEHESLAEVKQQASSWLPLLAKRCHSDTQVFLCSLFAPVCLDRPIY
PCRSLCEAVRAGCAPLMEAYGFPWPEMLHCHKFPLDNDLCIAVQFGHLPATAPPVTKICA
QCEMEHSADGLMEQMCSSDFVVKMRIKEIKIENGDRKLIGAQKKKKLLKPGPLKRKDTKR
LVLHMKNGAGCPCPQLDGLSGSFLVMGRKVDGQLLLMAVYRWDKKNKEMKFAVKFMFSYP
CSLYYPFFYGAAEPH
Download sequence
Identical sequences A0A2K5RUS5 F6ZL04
XP_002756546.1.60252 XP_017358243.1.71028 ENSCJAP00000051114

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]