SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5SBR7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5SBR7
Domain Number 1 Region: 569-626
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.18e-25
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 2 Region: 457-514
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.7e-24
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 3 Region: 37-88
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.44e-23
Family KRAB domain (Kruppel-associated box) 0.00078
Further Details:      
 
Domain Number 4 Region: 625-682
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.29e-23
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 5 Region: 401-458
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.66e-23
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 6 Region: 514-570
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.07e-20
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 7 Region: 345-402
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.95e-19
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 8 Region: 293-346
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000987
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 9 Region: 252-303
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000575
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 10 Region: 667-719
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000904
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 11 Region: 187-232
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000069
Family Classic zinc finger, C2H2 0.036
Further Details:      
 
Domain Number 12 Region: 99-154
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000891
Family Classic zinc finger, C2H2 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2K5SBR7
Sequence length 728
Comment (tr|A0A2K5SBR7|A0A2K5SBR7_CEBCA) Zinc finger protein 778 {ECO:0000313|Ensembl:ENSCCAP00000037836} KW=Complete proteome OX=1737458 OS=Cebus capucinus imitator. GN=ZNF778 OC=Platyrrhini; Cebidae; Cebinae; Cebus.
Sequence
MAAPDLAHRGRVSKDLVCLHGEQTQAAGMLAGWLIDSYQDSVTFDDVAVDFTQEEWTLLD
PSQRDLYRDVMLENYENLASVEWQLESKGSALQQDRAWFRASDETQMARSHSGGQLCDRM
QCGEAVSEPSDLSTHVRTQNTGYSCVCNHYGKDFLISHQKTLCKAGGQFSVLDQCGKAFS
TAPNVVYQQTCTWDKSFDYSNCGKAFLNQTYLQGRMRTHNREGTCKWKQCGKALTHSPGH
AATVEMHAVRNPHVYRECGKAFGCTAYLTSHMRIHTGEKPCEFKECGKSSPVSSSLTQHV
SIHAAEKPCECKECGRTVTGCSGLSQHVQAHAREKPYECKDCGKAYSRFYLLSEHLKTHM
REKPFACVVCGKYFRNSSCLNNHLRIHTGIKPYTCSYCGKAFTVRCGLTRHVRTHTGEKP
YMCKDCGKAFCTSSGLTEHVRTHTGEKPYECKDCGKSFTVSSSLTEHVRIHTGEKPYECK
QCGKAFTGRSGLTKHERTHTGEKPYECKDCGKAYNRVYLLNEHVKTHTEEKPFICKICGK
SFRNSSCLNKHVQIHTGIKPYECRDCGKTFTVSSSLTEHVRTHTGEKPYECKTCGKAFTT
SSHLIVHVRTHTGEKPYMCKECGKAFASSSHLIEHRRTHTGEKPYICNECGKAFRASSHL
RKHGRIHTGQKPYKCKDCGKAYNRFYLLKEHLKTYTEAQLFVCKDCGESFKNSSCLNHHT
QIHTEKPC
Download sequence
Identical sequences A0A2K5SBR7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]