SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5TJ65 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5TJ65
Domain Number 1 Region: 88-211
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 2.27e-33
Family Glutathione S-transferase (GST), C-terminal domain 0.000000562
Further Details:      
 
Domain Number 2 Region: 5-110
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.97e-26
Family Glutathione S-transferase (GST), N-terminal domain 0.000021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2K5TJ65
Sequence length 216
Comment (tr|A0A2K5TJ65|A0A2K5TJ65_MACFA) Uncharacterized protein {ECO:0000313|Ensembl:ENSMFAP00000000066} OX=9541 OS=Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey). GN= OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MQAGKPILYSYFRSSCSWRVRIALALKGIDYETVPINLIKDGGQQFSKDFQALNPMKQVP
ALKIDGITIHQSLAIIEYLEETRPTPRLLPQDPKKRASVRMISDLIAGGIQPLQNLSVLK
QVGEEFQLTWAQNAIISGFNALEQILQSTAGTYCVGDEVTMADLCLVPQVANAERFKVDC
TPYPTISSINKRLLVLEAFQVTHPCRQPDTPTELRA
Download sequence
Identical sequences A0A2K5TJ65 A0A2K6C967 F6PW84
ENSMMUP00000001461 XP_001101990.1.72884 XP_005561943.1.63531 XP_011764004.1.29376 9544.ENSMMUP00000001461 ENSMMUP00000001461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]