SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5TJ77 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5TJ77
Domain Number 1 Region: 5-50
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000893
Family EGF-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2K5TJ77
Sequence length 115
Comment (tr|A0A2K5TJ77|A0A2K5TJ77_MACFA) Neuregulin 4 {ECO:0000313|Ensembl:ENSMFAP00000000088} OX=9541 OS=Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey). GN=NRG4 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MPTDHEEPCGPSHKSFCLNGGLCYVIPTIPSPFCRCIENYTGARCEEVFLPSSSIQTKNN
LFEAFMALAVLITLIIGAFYFLCRKGHFQRASSVQYDVSLVETSSTSAHHSHGEH
Download sequence
Identical sequences A0A2K5TJ77
ENSMMUP00000033410 XP_001104381.1.72884 9544.ENSMMUP00000033410 ENSMMUP00000027477

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]