SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5TU73 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5TU73
Domain Number 1 Region: 2-104
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.9e-35
Family Thioltransferase 0.00000786
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2K5TU73
Sequence length 105
Comment (tr|A0A2K5TU73|A0A2K5TU73_MACFA) Uncharacterized protein {ECO:0000313|Ensembl:ENSMFAP00000003617} OX=9541 OS=Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey). GN= OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MVKQIESKAAFQEALNTAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVVFLEVDVD
DCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV
Download sequence
Identical sequences A0A0D9SC15 A0A2I3M4A4 A0A2K5M681 A0A2K5TU73 A0A2K6E687 A0A2K6MZG5 A0A2K6QBU5 F6RHG3
ENSMMUP00000013528 ENSMMUP00000021320 ENSMMUP00000013528 ENSMMUP00000021320 NP_001036197.2.72884 XP_005581157.1.63531 XP_007966650.1.81039 XP_007970262.1.81039 XP_010363877.1.97406 XP_011714964.1.29376 XP_011738635.1.29376 XP_011936873.1.92194 XP_014987044.1.72884 XP_017714740.1.44346 9544.ENSMMUP00000013528 9544.ENSMMUP00000021320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]