SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5TYF5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5TYF5
Domain Number 1 Region: 245-471
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.2e-64
Family Nuclear receptor ligand-binding domain 0.000000000877
Further Details:      
 
Domain Number 2 Region: 125-209
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.43e-27
Family Nuclear receptor 0.00005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2K5TYF5
Sequence length 472
Comment (tr|A0A2K5TYF5|A0A2K5TYF5_MACFA) Nuclear receptor subfamily 1 group H member 4 {ECO:0000313|Ensembl:ENSMFAP00000005110} OX=9541 OS=Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey). GN=NR1H4 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MGSKMNLIEHSHLPTTDEFSFSENLFGVLTEQVAGPLGQNLEVEPYSQYSNVQFPQVQPQ
ISSSSYYSNLGFYPQQPEEWYSPGIYELRRMPAESLYQGETEVAEMPVTKKPRMGASAGR
IKGDELCVVCGDRASGYHYNALTCEGCKGFFRRSITKNAVYKCKNGGNCVMDMYMRRKCQ
ECRLRKCKEMGMLAECLLTEIQCKSKRLRKNVKQHADQTMNEDSQGRDLRQVTSTTKSCR
EKTELTPDQQNLLHYIMDSYSKQKMPQEITNKILKEEFSAEENFLILTEMATNHVQVLVE
FTKKLPGFQTLDHEDQIALLKGSAVEAMFLRSAEIFNKKLPSGHSDLLEERIRNSGISDE
YITPMFSFYKSIGELKMTQEEYALLTAIVILSPDRQYIKDREAVEKLQEPLLDVLQKLCK
IHQPENPQHFACLLGRLTELRTFNHHHAEMLMSWRVNDHKFTPLLCEIWDVQ
Download sequence
Identical sequences A0A2K5NNT5 A0A2K5TYF5
ENSMMUP00000004758 XP_001090297.1.72884 XP_005572048.1.63531 XP_008002565.1.81039 XP_011760101.1.29376 XP_011822030.1.47321 XP_011888133.1.92194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]