SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5TYS2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5TYS2
Domain Number 1 Region: 143-251
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-25
Family Cadherin 0.00024
Further Details:      
 
Domain Number 2 Region: 252-367
Classification Level Classification E-value
Superfamily Cadherin-like 3e-23
Family Cadherin 0.0012
Further Details:      
 
Domain Number 3 Region: 363-486
Classification Level Classification E-value
Superfamily Cadherin-like 4.57e-23
Family Cadherin 0.00092
Further Details:      
 
Domain Number 4 Region: 64-150
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000136
Family Cadherin 0.0016
Further Details:      
 
Domain Number 5 Region: 473-577
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000257
Family Cadherin 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2K5TYS2
Sequence length 781
Comment (tr|A0A2K5TYS2|A0A2K5TYS2_MACFA) Cadherin 24 {ECO:0000313|Ensembl:ENSMFAP00000005233} OX=9541 OS=Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey). GN=CDH24 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MWGLVRLLLAWLGGWGCMGRLAAPARAWAGSRGHPGPALLRTRRSWVWNQFFVIEEYAGP
EPVLIGKLHSDVDRGEGRTKYLLTGEGAGTVFVIDEATGNIHVTKSLDREEKAQYVLLAQ
AVDRASNRPLEPPSEFIIKVQDINDNPPIFPLGPYHATVPEMSNVGTSVIQVTAHDADDP
SYGNSAKLVYTVLDGLPFFSVDPQTGVVRTAIPNMDRETQEEFLVVIQAKDMGGHMGGLS
GSTTVTVTLSDVNDNPPKFPQSLYQFSVVETAGPGTLVGRLRAQDPDLGDNALMAYSILD
GEGSEAFSISTDSQGRDGLLTVRKPLDFESRRSYAFRVEATNTLIDPAYLRRGPFKDVAS
VRVVVQDAPEPPAFTQAAYHLTVPENKAPGTLVGQISAADLDSPASPIRYSILPHSDPER
CFSIQPEEGTIHTAAPLDREARVWHNLTVLATELDSSAQASRVQVTIQTLDENDNAPQLA
EPYDTFVCDSAAPGQLIQVIQALDRDEVGNSSHVSFQGPLGPDANFTVRDNRDGSASLLL
PSRPAPPRQAPYLVPIELWDWGQPALSSTATVTVSVCRCQPDGSVASCWPEAHLSAAGLS
TGALLAIITCVGALLALVVLFVALRRQKQEALMVLEEEDVRENIITYDDEGGGEEDTEAF
DITALQNPDGAAPQAPGPPARRDVLPRARVSRQPRPPGPADVAQLLVLRLREADEDPSVP
PYDSVQVYGYEGRGSSCGSLSSLGSGSEAGGVPGPAEPLDDWGPLFRTLAELYGAKEPPA
P
Download sequence
Identical sequences A0A2K5TYS2 F6RAF1
XP_014998873.1.72884 XP_015309059.1.63531 XP_015309060.1.63531 ENSMMUP00000025018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]