SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5U1L0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5U1L0
Domain Number 1 Region: 35-148
Classification Level Classification E-value
Superfamily PH domain-like 3.54e-38
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.000041
Further Details:      
 
Domain Number 2 Region: 242-371
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 1.15e-29
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000135
Further Details:      
 
Domain Number 3 Region: 431-491
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00000000000123
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2K5U1L0
Sequence length 503
Comment (tr|A0A2K5U1L0|A0A2K5U1L0_MACFA) Wiskott-Aldrich syndrome {ECO:0000313|Ensembl:ENSMFAP00000006186} OX=9541 OS=Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey). GN=WAS OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MSGGPMGGRPGGRGAPAVQQNIPSTLLQDHENQRLFEMLGRKCLTLATAVVQLYLALPPG
AEHWTKEHCGAVCFVKDNPQKSYFIRLYGLQAGRLLWEQELYSQLVYSTPTPFFHTFAGD
DCQAGLNFADEGEAQAFRALVQEKIQKRNQRQSGDRRQLLPPPPPANEERRGGLPPLPPH
PGGDQGGPPVGPLSLGLATVDIQNPDITSSRYRGLPAPGPSPADKKRSGKKKISKADIGA
PSGFKHVTHVGWDPQNGFDVNNLDPDLRSLFSRAGISEAQLTDAETSKLIYDFIEDQGGL
EAVRQEMRRQEPLPPPPPPSRGGNQPPRPPIVGGNKGRSGPLPPVPLGVAPPPPTPRGPP
PPGRGGPLPPPPPATGRSGPPPPPPPGAGGPPMPPPPPPPPPPPPSSGNGPAPPLLPPAL
VPAGGLAPGGGRGALLDQIRQGIQLNKTPGAPESSALQPPPQSSEGLVGALMHVMQKRSR
AIHSSDEGEDQAGDEDEDDEWDD
Download sequence
Identical sequences A0A2K5P5R1 A0A2K5U1L0 A0A2K5YML9 A0A2K6CB78 H9ZD75
XP_005593541.1.63531 XP_011760173.1.29376 XP_011846804.1.47321 XP_011846805.1.47321 XP_011887656.1.92194 XP_014982856.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]