SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5UAQ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5UAQ2
Domain Number 1 Region: 55-295
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 0.00000000000000253
Family Spore coat polysaccharide biosynthesis protein SpsA 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2K5UAQ2
Sequence length 626
Comment (tr|A0A2K5UAQ2|A0A2K5UAQ2_MACFA) Collagen beta(1-O)galactosyltransferase 2 {ECO:0000313|Ensembl:ENSMFAP00000009426} OX=9541 OS=Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey). GN=COLGALT2 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MAARPAATLAWSLLLLSSALLREGCRARFAAEPDSEDDGEEPVVFPESPLQSPTVLVAVL
ARNAAHTLPHFLGCLERLDYPKSRMAIWAATDHNVDNTTEILREWLKNVQRLYHYVEWRP
MDEPESYPDEIGPKHWPSSRFAHVMKLRQAALRTAREKWSDYILFIDVDNFLTNPQTLNL
LIAENKTIVAPMLESRGLYSNFWCGITPKGFYKRTPDYVQIREWKRSGCFPVPMVHSTFL
IDLRKEASDKLTFYPPHQDYTWTFDDIIVFAFSSRQAGIQMYLCNREHYGYLPIPLKSHQ
TLQEDIENLIHVQIEAMIDRPPMEPSKYVSLVPKYPDKMGFDEIFMINLKRRKDRRDRML
RTLYEQEIEVKIVEAVDGKALNTSQLKALNIEMLPGYRDPYSSRPLTRGEIGCFLSHYSV
WKEVIDRELEKTLVIEDDVRFEHQFKKKLMKLMDDIDQAQLDWELIYIGRKRMQVKEPEK
AVPNVANLVEADYSYWTLGYVISLEGAQKLVGADPFGKMLPVDEFLPIMYNKHPVAEYKE
YYESRDLKAFSAEPLLIYPTHYTGQPGYLSDTETSTIWDNETVATDWDRTHAWKSRKQSR
IYSSAKNTEALPPPTSLDTVPSRDEL
Download sequence
Identical sequences A0A2K5NGE0 A0A2K5UAQ2
9544.ENSMMUP00000021546 XP_005540276.1.63531 XP_011903264.1.92194 XP_014977511.1.72884 ENSMMUP00000021546 ENSMMUP00000021546

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]