SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5UC06 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5UC06
Domain Number 1 Region: 55-835
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.64e-293
Family Motor proteins 1.77e-16
Further Details:      
 
Domain Number 2 Region: 836-961
Classification Level Classification E-value
Superfamily Myosin rod fragments 5.67e-22
Family Myosin rod fragments 0.00034
Further Details:      
 
Domain Number 3 Region: 956-1071
Classification Level Classification E-value
Superfamily Myosin rod fragments 7.41e-21
Family Myosin rod fragments 0.0011
Further Details:      
 
Domain Number 4 Region: 1242-1349
Classification Level Classification E-value
Superfamily Myosin rod fragments 1.02e-17
Family Myosin rod fragments 0.0028
Further Details:      
 
Domain Number 5 Region: 1060-1150
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000000222
Family Myosin rod fragments 0.0037
Further Details:      
 
Domain Number 6 Region: 1348-1450
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000012
Family Myosin rod fragments 0.01
Further Details:      
 
Domain Number 7 Region: 1515-1617
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000144
Family Myosin rod fragments 0.0011
Further Details:      
 
Domain Number 8 Region: 1748-1849
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0000518
Family Regulator of G-protein signaling, RGS 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2K5UC06
Sequence length 1949
Comment (tr|A0A2K5UC06|A0A2K5UC06_MACFA) Myosin heavy chain 9 {ECO:0000313|Ensembl:ENSMFAP00000009896} OX=9541 OS=Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey). GN=MYH9 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MAQQAADKYLYVDKNFINNPLAQADWAAKKLVWVPSDKSGFEPASLKEEVGEEAIVELVE
NGKKVKVNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLKERYYSGLIYTYSGLFCVV
INPYKNLPIYSEEIVEMYKGKKRHEMPPHIYAITDTAYRSMMQDREDQSILCTGESGAGK
TENTKKVIQYLAYVASSHKSKKDQGELERQLLQANPILEAFGNAKTVKNDNSSRFGKFIR
INFDVNGYIVGANIETYLLEKSRAIRQAKEERTFHIFYYLLSGAGEHLKTDLLLEPYNKY
RFLSNGHVTIPGQQDKDMFQETMEAMRIMGIPEEEQMGLLRVISGVLQLGNIVFKKERNT
DQASMPDNTAAQKVSHLLGINVTDFTRGILTPRIKVGRDYVQKAQTKEQADFAIEALAKA
TYERMFRWLVLRINKALDKTKRQGASFIGILDIAGFEIFDLNSFEQLCINYTNEKLQQLF
NHTMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIEKPAGPPGILALLDEECWFPKATDK
SFVEKVMQEQGTHPKFQKPKQLKDKADFCIIHYAGKVDYKADEWLMKNMDPLNDNIATLL
HQSSDKFVSELWKDVDRIIGLDQVAGMSETALPGAFKTRKGMFRTVGQLYKEQLAKLMAT
LRNTNPNFVRCIIPNHEKKAGKLDPHLVLDQLRCNGVLEGIRICRQGFPNRVVFQEFRQR
YEILTPNSIPKGFMDGKQACVLMIKALELDSNLYRIGQSKVFFRAGVLAHLEEERDLKIT
DVIIGFQACCRGYLARKAFAKRQQQLTAMKVLQRNCAAYLKLRNWQWWRLFTKVKPLLQV
SRQEEEMMAKEEELVKVREKQLAAENRLTEMETLQSQLMAEKLQLQEQLQAETELCAEAE
ELRARLTAKKQELEEICHDLEARVEEEEERCQHLQTEKKKMQQNIQELEEQLEEEESARQ
KLQLEKVTTEAKLKKLEEEQIILEDQNCKLAKEKKLLEDRIAEFTTNLTEEEEKSKSLAK
LKNKHEAMITDLEERLRREEKQRQELEKTRRKLEGDSTDLSDQIAELQAQIAELKMQLAK
KEEELQAALARVEEEAAQKNMALKKIRELESQISELQEDLESERASRNKAEKQKRDLGEE
LEALKTELEDTLDTTAAQQELRSKREQEVNILKKTLEEEAKTHEAQIQEMRQKHSQAVEE
LAEQLEQTKRVKANLEKAKQTLENERGELANEVKVLLQGKGDSEHKRKKVEAQLQELQVK
FNEGERVRTELADKVTKLQVELDNVTGLLSQSDSKSSKLTKDFSALESQLQDTQELLQEE
NRQKLSLSTKLKQVEDEKNSFREQLEEEEEAKHNLEKQIATLHAQVADMKKKMEDSVGCL
ETAEEVKRKLQKDLEGLSQRHEEKVAAYDKLEKTKTRLQQELDDLLVDLDHQRQSACNLE
KKQKKFDQLLAEEKTISAKYAEERDRAEAEAREKETKALSLARALEEAMEQKAELERLNK
QFRTEMEDLMSSKDDVHELEKSKRALEQQVEEMKTQLEELEDELQATEDAKLRLEVNLQA
MKAQFERDLEEKKKQLVRQVREMEAELEDERKQRSMAVAARKKLEMDLKDLEAHIDSANK
NREEAIKQLRKLQAQMKDCMRELDDTRASREEILAQAKENEKKLKSMEAEMIQLQEELAA
AERAKRQAQQERDELADEIANSSGKGALALEEKRRLEARIAQLEEELEEEQGNTELINDR
LKKANLQIDQINTDLNLERSHAQKNENARQQLERQNKELKVKLQEMEGTVKSKYKASITA
LEAKIAQLEEQLDNETKERQAACKQVRRTEKKLKDVLLQVDDERRNAEQYKDQADKASTR
LKQLKRQLEEAEEEAQRANASRRKLQRELEDATETADAMNREVSSLKNKLRRGDLPFVMP
RRMARKGAGDGSDEEVDGKADGAEAKPAE
Download sequence
Identical sequences A0A1D5R424 A0A2I3M0W4 A0A2K5LIJ1 A0A2K5UC06 A0A2K6B6K6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]