SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5UCY8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5UCY8
Domain Number 1 Region: 268-332
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000119
Family LIM domain 0.058
Further Details:      
 
Domain Number 2 Region: 328-394
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000143
Family LIM domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2K5UCY8
Sequence length 421
Comment (tr|A0A2K5UCY8|A0A2K5UCY8_MACFA) Testin LIM domain protein {ECO:0000313|Ensembl:ENSMFAP00000010212} OX=9541 OS=Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey). GN=TES OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MDLENKVKKMGLGHEQGFGAPCLKCKEKCEGFELHFWRKICRNCKCGQEEHDVLLSNEED
RKVGKLFEDTKYTTLIAKLKSDGIPMYKRNVMILTNPVAAKKNVSINTVTYEWAPPVQNQ
ALARQYMQMLPKEKQPVAGSEGAQYRKKQLAKQLPAHDQDPSKCHELSPREVKEMEQFVK
KYKSEALGVGDVKLPCEMDAQGPKQMNIPGGDRSTPAAVGAMEDKSAEHKRTQYSCYCCK
LSMKEGDPAIYAERAGYDKLWHPACFVCSTCHELLVDMIYFWKNEKLYCGRHYCDSEKPR
CAGCDELIFSNEYTQAENQNWHLKHFCCFDCDSILAGEIYVMVNDKPVCKPCYVKNHAVV
CQGCHNAIDPEVQRVSYNNFSWHASTECFLCSCCSKCLIGQKFMPVEGMVFCSVECKKMM
S
Download sequence
Identical sequences A0A0D9REW2 A0A2K5KYD6 A0A2K5UCY8 A0M8R4 F7ERF2 Q2IBA3
ENSMMUP00000009299 ENSMMUP00000009299 NP_001162149.1.72884 XP_005550630.1.63531 XP_007980861.1.81039 XP_011943191.1.92194 9544.ENSMMUP00000009299

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]