SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5UCZ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5UCZ3
Domain Number 1 Region: 5-64
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.96e-26
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 2 Region: 408-464
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.4e-25
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 3 Region: 267-324
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.75e-24
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 4 Region: 351-408
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.55e-23
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 5 Region: 547-604
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.65e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 6 Region: 211-268
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.16e-22
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 7 Region: 491-548
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.4e-22
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 8 Region: 589-641
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.02e-19
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 9 Region: 314-346
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000236
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 10 Region: 454-486
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000268
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Weak hits

Sequence:  A0A2K5UCZ3
Domain Number - Region: 169-206
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000259
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number - Region: 129-179
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0304
Family Classic zinc finger, C2H2 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2K5UCZ3
Sequence length 659
Comment (tr|A0A2K5UCZ3|A0A2K5UCZ3_MACFA) Uncharacterized protein {ECO:0000313|Ensembl:ENSMFAP00000010217} OX=9541 OS=Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey). GN= OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MNKSLGPVSFKDVAVDFTQEEWQQLDPEQKITYRDVMLENYSNLVSVGYHIIKPDVISKL
EQGEEPWIVEGEFLLQSYPDEVWQADDLIERIQEGENKPSRQTVFTETLIEEREYISSDG
SYARMKADECSGCGKSLLHIKLEKTHPGDKAYEFNQNGKPYTLNEESLYQKIHILEKPFE
YIECQKAFQKDTVFVNHMEEKPYKWNGSEIAFLQMSDLTVHQASHMEMKPYECSECGKSF
CKKSKFIIHQRTHTGEKPYECNQCGKSFCQKGTLTVHQRTHTGEKPYECNECGKNFYQKL
HLIQHQRTHSGEKPYECSYCGKSFCQKTHLTQHQRTHSGERPYVCHDCGKTFSQKSALND
HQKIHTGVKLYKCSECGKCFCRKSTLTTHLRTHTGEKPYECNECGKFFSRLSYLTVHYRT
HSGEKPYECNECGKTFYLNSALMRHQRVHTGEKPYECNECGKLFSQLSYLTIHHRTHSGV
KPYECSECGKTFYQNSALCRHRRIHKGEKPYECYICGKFFSQMSYLTIHHRIHSGEKPYE
CSECGKTFCQNSALNRHQRTHTGEKAYECYECGKCFSQMSYLTIHHRIHSGEKPFECNEC
GKAFSRMSYLTVHYRTHSGEKPYECTECGKKFYHKSAFNSHQRIHRRGNMNVIDVGRLL
Download sequence
Identical sequences A0A2K5UCZ3 F7DP29
ENSMMUP00000016206 9544.ENSMMUP00000035495 ENSMMUP00000035495

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]