SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5UGH7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5UGH7
Domain Number 1 Region: 29-217,317-413
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.74e-46
Family Bacterial dinuclear zinc exopeptidases 0.0046
Further Details:      
 
Domain Number 2 Region: 206-308
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 1.09e-21
Family Bacterial exopeptidase dimerisation domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2K5UGH7
Sequence length 436
Comment (tr|A0A2K5UGH7|A0A2K5UGH7_MACFA) Peptidase M20 domain containing 2 {ECO:0000313|Ensembl:ENSMFAP00000011478} OX=9541 OS=Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey). GN=PM20D2 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MRPGVERSVEGGAYDGSSELELLKLRAAECIDKAAERLGALSRAIWSQPELAYEEHHAHR
VLTHFFEREPPAASWAVQPHYQLPTAFRAEWEPPEARAPSAAPRPLHLGFLCEYDALPGI
GHACGHNLIAEVGAAAALGVRGALEGLPRPPPPVKVIVLGTPAEEDGGGKIDLIEAGAFT
NLDVVFMAHPSQENAAYLPDMAEHDVTVKYYGKASHSAAYPWEGLNALDAAVLAYNNLSV
FRQQMKPTWRVHGIIKNGGVKPNIIPSYSELIYYFRAPSMKELQVLTKKAEDCFRAAALA
SGCTVEIKSGAHDYYNVLPNKSLWKAYMENGRKLGIEFISEDKMLNGPSGSTDFGNVTFV
VPGIHPYFHIGSNALNHTEQYTEAAGSQEAQFYTLRTAKALAMTALDVIFKPELLERIRE
DFKLKLQEEQFVNAVE
Download sequence
Identical sequences A0A2K5UGH7 F6TN77
9544.ENSMMUP00000019599 ENSMMUP00000019599 XP_001095121.1.72884 XP_005552436.1.63531 ENSMMUP00000019599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]