SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5UPC7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5UPC7
Domain Number 1 Region: 7-146
Classification Level Classification E-value
Superfamily C-type lectin-like 5.77e-31
Family C-type lectin domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2K5UPC7
Sequence length 236
Comment (tr|A0A2K5UPC7|A0A2K5UPC7_MACFA) Chondrolectin {ECO:0000313|Ensembl:ENSMFAP00000014266} OX=9541 OS=Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey). GN=CHODL OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MAYFHELSSRVSFQEARLACESEGGVLLSLENEAEQKLIESMLQNLTKPGTGISDGDFWI
GLWRNGDGQTSGACPDLYQWSDGSSSQYRNWYTDEPSCGSEKCVVMYHQPTANPGLGGPY
LYQWNDDRCNMKHNYICKYEPEINPTAPAEKPYLTNQPGDTHQNVVVTEAVKEEQKLVQT
SPHCGFQRAAEKKVAWKYSNSLTWFQNFVILNLYKEWHQNISLEWLEITKDLQDEL
Download sequence
Identical sequences A0A2K5UPC7 A0A2K6C0K2
ENSMMUP00000028783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]