SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5UTU3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5UTU3
Domain Number 1 Region: 42-123
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.65e-17
Family Glutathione S-transferase (GST), N-terminal domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2K5UTU3
Sequence length 147
Comment (tr|A0A2K5UTU3|A0A2K5UTU3_MACFA) Uncharacterized protein {ECO:0000313|Ensembl:ENSMFAP00000015875} OX=9541 OS=Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey). GN= OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MATPNNLTPTNCSWWPISALESDAAKPAEAPDAPEAASPAHWPRESLVLYHWTQSFSSQK
VRLVIAEKGLVCEERDVSLPQSEHKEPWFMRLNLGEEVPVIIHRDNIISDYDQIIDYVER
TFTGGARQAASLELRGANPQGRLGRAQ
Download sequence
Identical sequences A0A2I3LJX1 A0A2K5UTU3 A0A2K5ZV55 A0A2K6CBA3 F7GY98
ENSMMUP00000003799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]