SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5UV52 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5UV52
Domain Number 1 Region: 318-455
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.27e-32
Family Synaptotagmin-like (S variant) 0.00022
Further Details:      
 
Domain Number 2 Region: 178-314
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.42e-31
Family Synaptotagmin-like (S variant) 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2K5UV52
Sequence length 470
Comment (tr|A0A2K5UV52|A0A2K5UV52_MACFA) Synaptotagmin 17 {ECO:0000313|Ensembl:ENSMFAP00000016319} OX=9541 OS=Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey). GN=SYT17 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MLEPLNEGFLSRLSDLLLCRWTCRHCCQKCYESSCCQSSEDEVEILGPFPAQTPPWLMAS
RSSDKDGDSVHTASEVPLTPRTNSPDGRRSSSDTSKSTYSLTRRISSLESRRPSSPLIDI
KPIEFGVLSAKKEPIQPSVLRRTYTPDDYFRKFEPHLYSLDSSSDDVDSLTDEEILSKYQ
LGMLHFSTQYDLLHNHLTVRVIEARDLPPPISHDGSRQDMAHSNPYVKICLLPDQKNSKQ
TGVKRKTQKPVFEERYTFEIPFLEAQRRTLLLTVVDFDKFSRHCVIGKVSVPLCEVDLVK
GGHWWKALIPSSQNEVELGELLLSLNYLPSAGRLNVDVIRAKQLLQTDVSQGSDPFVKIQ
LVHGLKLVKTKKTSFLRGTIDPFYNESFSFKVPQEELENASLVFTVFGHNMKSSNDFIGR
IVIGQYSSGPSESNHWRRMLNTHRTAVEQWHSLRSRAECDRVSPASLEVT
Download sequence
Identical sequences A0A096MWV5 A0A2K5HNN1 A0A2K5M992 A0A2K5UV52 A0A2K5XHA3
ENSPANP00000004363 XP_005591414.1.63531 XP_011710304.1.29376 XP_011787243.1.43180 XP_011831474.1.47321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]