SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5V0X5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5V0X5
Domain Number 1 Region: 295-584
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.37e-26
Family WD40-repeat 0.0074
Further Details:      
 
Domain Number 2 Region: 16-123
Classification Level Classification E-value
Superfamily L domain-like 2.28e-18
Family Internalin LRR domain 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2K5V0X5
Sequence length 647
Comment (tr|A0A2K5V0X5|A0A2K5V0X5_MACFA) Leucine rich repeats and WD repeat domain containing 1 {ECO:0000313|Ensembl:ENSMFAP00000018368} OX=9541 OS=Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey). GN=LRWD1 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MGPLSARLLMQRGRPKSDRLGKIRSLDLSGLELLSEHLDPKLLCRLTQLQELDLSNNQLE
TLPDNLGLSHLRVLRCANNQLGDVTALCQFPKLEELSLEGNPFLTVNDNLKVSFLLPTLR
KVNGKDASSTYSQVENLNRELTSRVTAHWEKFMATLGPEEEAEKAQADFVKSAVRDVRYG
PESLSEFTQWRVRMISEELVASSRTQVHEADSPEKPPEAGAAHKPRARLAALKRPDDVPL
NLSPSKRACASPSAQVEGGPVAGSDGSQPALKLEPLHFLQCHSKNNSPQDLETQLWACAF
EPAWEEGATSQTVATCGGEAVCVIDCQTGIVLHKYKAPGEEFFSVAWTALMVVTQAGHKK
RWSVLAAAGLRGLVRLLHVRAGFCCGVIRAHKKAIATLCFSPAHETHLFTASYDKRIILW
DIGMPNQDYEFQASQLLTLDTTSIPLRLCPVASCPDARLLAGCEGGCCCWDVRLDQPQKR
RVCEVEFVFSEGSEASGRRVDGLAFVNEDVVASKGSGLGTICLWSWRQTWGGRGSQSTVA
VVVLARLQWSPTELAYFSLSACPDKGIVLCGDEEGNVWLYDVSNILKQPPPLPAAPQAPT
QILKWPQPWALGQAVTKTMVNTVVANASFTYLTALTDSNIVAIWGRL
Download sequence
Identical sequences A0A2K5V0X5 A0A2K6DFB2 H9Z209
ENSMMUP00000015768 ENSMMUP00000015768 NP_001252971.1.72884 XP_005549370.1.63531 XP_011758311.1.29376 9544.ENSMMUP00000015768

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]