SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5V562 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5V562
Domain Number 1 Region: 136-315
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 2.96e-25
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.0057
Further Details:      
 
Domain Number 2 Region: 86-130
Classification Level Classification E-value
Superfamily TGS-like 0.0000687
Family TGS domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2K5V562
Sequence length 338
Comment (tr|A0A2K5V562|A0A2K5V562_MACFA) Mitochondrial ribosomal protein L39 {ECO:0000313|Ensembl:ENSMFAP00000019850} OX=9541 OS=Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey). GN=MRPL39 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MEALTMGVRALRLWRVASGLGISWRFIATSPASQLSPTELTEMRNDLFNKEKARQLSLTP
RTEKIEVKHVGKTDPGTVFVMNKNISTPYSCAMHLSEWYCRKSILALVDGQPWDMYKPLT
KSCEIKFLTFKDRDPGEVNKAYWRSCAMMMGCVIERAFKDEYMVNLVRAPEVPVISGAFC
YDVVLDSKLDEWMPTKENLRSFTKDAHALIYKDLPFETLEVEAKVALEIFQHNKYKIDFI
EEKASQNPERIVKLHRIGDFIDVSEGPLIPRTSICFQYEVSAVHNLQPTQPSLIRRFQGV
SLPIHLRAHFTIWDKLLERSRKMVTEDQTKPTEECTST
Download sequence
Identical sequences A0A2K5V562
XP_001105710.1.72884 XP_005548957.1.63531 ENSMMUP00000023169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]