SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5V7G0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5V7G0
Domain Number 1 Region: 127-267
Classification Level Classification E-value
Superfamily Second domain of FERM 6.02e-16
Family Second domain of FERM 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2K5V7G0
Sequence length 464
Comment (tr|A0A2K5V7G0|A0A2K5V7G0_MACFA) FERM domain containing 8 {ECO:0000313|Ensembl:ENSMFAP00000020678} OX=9541 OS=Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey). GN=FRMD8 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MDGTEGSTGQPGPAERSHRSSVSSVGARAADVLVYLADDTVVPLAVENLPSLSAHELHRA
VREVLQLPDIALDVFALWLVSPLLEVQLKPKHQPYKLGRQWPELLLRFTSAPDDDVAMDE
PFLQFRRNVFFPKRRELQIRDEEVLRLLYEEAKGNVLAARYPCDVEDCEALGALVCRVQL
GPYQPGQPAACALREKLDSFLPAHLCKRGQGLFAALRGRGTRAGPGEQGLLNAYRQVQEV
GSDGGCEAALGTHYRAYLFKCHELPFYGCAFFHGEVDKPAQGFLHRGGRKPVSVAISLEG
VHVIDSREKHVLLGLRFQELSWDHTSPEEEEPILWLEFDGDSEGTPVNKLLKIYSKQAEL
MSSLIEYCIELSQVAEPAGPQDSATGPPSDPSSSPAPVERPKLRRQGSVVSSRIQHLSTI
DYVEDGKGIRRVKPKRTTSFFSRQLSLGQGSYTVVQPSDSLEQG
Download sequence
Identical sequences A0A1D5QDW9 A0A2K5V7G0
NP_001247833.1.72884 XP_005577334.1.63531 ENSMMUP00000030670 ENSMMUP00000030670 9544.ENSMMUP00000030670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]