SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5VA53 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5VA53
Domain Number 1 Region: 126-374
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.62e-69
Family Nuclear receptor ligand-binding domain 0.00000000119
Further Details:      
 
Domain Number 2 Region: 57-140
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.43e-30
Family Nuclear receptor 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2K5VA53
Sequence length 417
Comment (tr|A0A2K5VA53|A0A2K5VA53_MACFA) Hepatocyte nuclear factor 4 alpha {ECO:0000313|Ensembl:ENSMFAP00000021588} OX=9541 OS=Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey). GN=HNF4A OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MRLSKTLVDMDMADYSAALDPAYTTLEFENVQVLTMGNDTSPSEGTNLNAPNSLGVSALC
AICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYSCRFSRQCVVDKDKRNQCRYCRLKKC
FRAGMKKEAVQNERDRISTRRSSYEDSSLPSINALLQAEVLSRQITSPVSGINGDIRAKK
IASIADVCESMKEQLLVLVEWAKYIPAFCELPLDDQVALLRAHAGEHLLLGATKRSMVFK
DVLLLGNDYIVPRHCPELAEMSRVSMRILDELVLPFQELQIDDNEYAYLKAIIFFDPDAK
GLSDPGKIKRLRSQVQVSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFIKL
FGMAKIDNLLQEMLLGGPCQAQEGQGWRGDSLGDPHTDLSSPLSSLASPLCSFGQVA
Download sequence
Identical sequences A0A2K5VA53 A0A2K6E2F9
ENSMMUP00000008519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]