SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5VCS0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5VCS0
Domain Number 1 Region: 367-473
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000377
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 2 Region: 471-603
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000091
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 3 Region: 209-254
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000192
Family EGF-type module 0.021
Further Details:      
 
Domain Number 4 Region: 333-382
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000099
Family EGF-type module 0.0064
Further Details:      
 
Domain Number 5 Region: 283-326
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000321
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2K5VCS0
Sequence length 710
Comment (tr|A0A2K5VCS0|A0A2K5VCS0_MACFA) Fibulin 1 {ECO:0000313|Ensembl:ENSMFAP00000022504} OX=9541 OS=Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey). GN=FBLN1 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
AERLSVLMLSACSLPCTVDADVLLEACCADGQRMATNQKDCSLPYATESKECRAVGLASL
CQDLNGAREWAVWKVGRASQAEGTAQRRGMVQEQCCHSQLEELHCATGIRLANEQDHCAA
PRGDNASLEATFVKRCCHCCLLGRAAQAQGQSCEYSLMVGYQCGQVFRACCVKSQETGDL
DVRSLQETDKITEVQEEQEDPYLNDRCRGGGPCKQQCRDTGDEVVCSCFVGYQLLSDGVS
CEDVNECITGSHSCRLGESCINTVGSFRCQRDSSCGTGYELTEDNSCKDIDECESGIHNC
LPDFICQNTLGSFRCRPKLQCKSGFIQDALGNCIDINECLSISAPCPTGHTCINTEGSYT
CQKNVPNCGRGYHLNEEGTRCVDVDECAPPAEPCGRGHRCVNSPGSFRCECKTGYYFDGI
SRMCVDVNECQRYPGRLCGHKCENTLGSYVCSCSVGFRLSVDGRSCEDINECSSSPCSQE
CANVYGSYQCYCRRGYQLSDVDGVTCEDIDECALPTGGHICSYRCINIPGSFQCSCPSSG
YRLAPNGRNCQDIDECVTGIHNCSINETCFNIQGGFRCLVFECPENYRRSAATRCERLPC
HENRECSKLPLRITYYHLSFPTNIQAPAVVFRMGPSSAVPGDSMQLAITGGNEEGFFTTR
KVSPHSGVVALTKPVPEPRDLLLTVKMDLYRHGTVSSFVAKLFIFVSAEL
Download sequence
Identical sequences A0A2K5VCS0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]