SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5VE28 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5VE28
Domain Number 1 Region: 80-163
Classification Level Classification E-value
Superfamily PA domain 0.00000000889
Family PA domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2K5VE28
Sequence length 188
Comment (tr|A0A2K5VE28|A0A2K5VE28_MACFA) Protease associated domain containing 1 {ECO:0000313|Ensembl:ENSMFAP00000022972} OX=9541 OS=Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey). GN=PRADC1 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MVPGAAGWCCLVLWLPACVAAHGFRIHDYLYFQVLSPGDIRYIFTATPAKDFGGIFHTRY
EQIHLVPAEPPEACGELSNGFFIQDQIALVERGGCSFLSKTRVVQEHGGRAVIISDNAVD
NDSFYVEMIQDSTQRTADIPALFLLGRDGYMIRRSLEQHGLPWAIISIPVNVTSIPTFEL
LQPPWTFW
Download sequence
Identical sequences A0A096NRM4 A0A2K5LE44 A0A2K5VE28 A0A2K5ZXF4 A0A2K6DYZ9 G1RHG9 G3QXN9 H2QI44 H9G0P0 Q9BSG0
ENSP00000258083 ENSMMUP00000016340 9544.ENSMMUP00000016340 9598.ENSPTRP00000020695 9606.ENSP00000258083 ENSPTRP00000020695 ENSNLEP00000012669 NP_115695.1.87134 NP_115695.1.92137 XP_003262599.1.23891 XP_007968414.1.81039 XP_011711898.1.29376 NYSGRC-14150090 gi|14150090|ref|NP_115695.1| ENSGGOP00000007592 ENSPTRP00000020695 ENSP00000258083 ENSGGOP00000007592 ENSMMUP00000016340 ENSNLEP00000012669 ENSPANP00000015694 ENSP00000258083

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]