SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5W3B3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5W3B3
Domain Number 1 Region: 433-489
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.02e-23
Family Classic zinc finger, C2H2 0.0027
Further Details:      
 
Domain Number 2 Region: 489-545
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.02e-23
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 3 Region: 321-377
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.42e-23
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 4 Region: 9-69
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.22e-22
Family KRAB domain (Kruppel-associated box) 0.0016
Further Details:      
 
Domain Number 5 Region: 377-433
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.91e-21
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 6 Region: 264-321
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.13e-19
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 7 Region: 534-586
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.83e-19
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 8 Region: 130-174
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000721
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2K5W3B3
Sequence length 636
Comment (tr|A0A2K5W3B3|A0A2K5W3B3_MACFA) Zinc finger protein 792 {ECO:0000313|Ensembl:ENSMFAP00000031567} OX=9541 OS=Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey). GN=ZNF792 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MAEAALRDPAQGCVTFEDVTIYFSQEEWGLLDEAQRLLYCDVMLENFALIASLGLISFRS
HIVSQLEMGKEPWVPDSVDMTSAMARGAYGRPGSDFCCRTEGKDLPSEHNVSVEGVAHDR
SPEATLCLQKTCPYDICGLHLKDILHLAEHQTTHPRQKPFLCEAYVKGSEFSANLPQRQV
QQNVHNPERIRREEDQALPVKTWGDHTSDQLSTCREGGEDFVATAGFLQREFTPSDGEPH
KATESMVDFHIALRHNKCCDSGDAFSDKSTLVQHQRIHSRERPYECSKCGIFFTYAADLT
QHQKVHNRGKPYECCECGKFFSQHSSLVKHRRVHTGESPHVCGDCGKFFSRSSNLIQHKR
VHTGEKPYECSECGKFFSQRSNLIHHKRVHTGRSAHECSECGKSFNCNSSLIKHWRVHTG
ERPYKCNECGKFFSHIASLIQHQIVHTGERPHGCSECGKAFSRSSDLMKHQRVHTGERPY
ECRECGKLFSQSSSLNSHRRLHTGERPYQCSECGKFFNQSSSLHNHRRLHTGERPYECSE
CGKTFRQRSNLRQHLKVHKPDRPYECSECGKAFNQRPTLIRHQKIHTRERSMENVLLPCS
MQQHTPEISSENRPYEGAVNYKLNFVHPSTHPGEVP
Download sequence
Identical sequences A0A2K5W3B3
XP_005588864.1.63531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]