SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5W601 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5W601
Domain Number 1 Region: 257-395
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.84e-26
Family UBX domain 0.0095
Further Details:      
 
Domain Number 2 Region: 3-115
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000372
Family Thioltransferase 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2K5W601
Sequence length 508
Comment (tr|A0A2K5W601|A0A2K5W601_MACFA) UBX domain protein 4 {ECO:0000313|Ensembl:ENSMFAP00000032505} OX=9541 OS=Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey). GN=UBXN4 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MLWFQGAIPAAIATAKRSGAVFVVFVAGDDEQSTRMAASWEDDKVTEASSNSFVAIKIDT
KSEACLQFSQIYPVVCVPSSFFIGDSGIPLEVIAGSVSADELVTRIHKVRQMHSLKSEAL
VANGSQSESSVSTPSASFEPDNTCENSESRNAELCEIPPTSDTKSDTATGGESAGHATSS
QEPSGCSDQRPAEDLNIRVERLTKKLEERREEKRKEEEQREIKKEIERRKTGKEMLDYKR
KQEEELTKRMLEERNREKAEDRAARERIKQQIALDRAERAARFAKTKEEVEAAKAAALLA
KQAEMEVKRESYARERSTVARIQFRLPDGSSFTNQFPSDAPLEEARQFAAQTVGNTYGNF
SLATMFPRREFTKEDYKKKLLDLELAPSASVVLLPAGRPTASIVHSSSGDIWTLLGTVLY
PFLAIWRLISNFLFSNPPPTQTSVRVTSSEPPNPASSSKSEKREPVRKRVLEKRGDDFKK
EGKIYRLRTQDDGEDENNTWNGNSTQQM
Download sequence
Identical sequences A0A2K5W601 F6V7D5
ENSMMUP00000016063 9544.ENSMMUP00000016063 ENSMMUP00000016063 XP_005573097.1.63531 XP_014965494.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]